Transcription Factor

						

			
Accessions: 1k78_B (3D-footprint 20231221)

			
Names: C-ets-1 Protein, ETS1_MOUSE, p54, Protein C-ets-1
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P27577
Length: 102
Pfam Domains:      1-82 Ets-domain
Sequence: 
(in bold interface residues)		   1 IQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLR   60
  61 YYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Interface Residues: 31, 35, 36, 39, 53, 54, 56, 57, 58, 60, 61, 75
3D-footprint Homologues: 2wbs_A, 4uno_A, 3jtg_A, 7jsa_J, 3zp5_A, 2stt_A, 8ee9_F, 4mhg_A, 1dux_F, 4l18_B, 1yo5_C, 1awc_A, 4lg0_B, 4bqa_A, 1bc8_C, 4iri_A
Binding Motifs: 1k78_BI tGGnnnnnnnntCCG
			
Publications: Garvie C. W., Hagman J., Wolberger C. Structural studies of Ets-1/Pax5 complex formation on DNA.. Mol. Cell 8:1267-1276 (2001). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.