Transcription Factor

						

			
Accessions: TEF_DBD (HumanTF 1.0), TEF_TF1 (HumanTF2 1.0), TEF_TF2 (HumanTF2 1.0)

			
Names: Basic krueppel-like factor, CACCC-box-binding protein BKLF, KLF3_HUMAN, Krueppel-like factor 3, TEF, TEF-2, TEA domain family member 4, TEAD-4, TEAD4_HUMAN, Transcription factor 13-like 1, Transcription factor RTEF-1, Transcriptional enhancer factor TEF-3
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P57682
Notes: Ensembl ID: ENSG00000167074; DNA-binding domain sequence; TF family: bZIP; Clone source: MGC, Ensembl ID: ENSG00000167074; Construct type: TF1(SBP); TF family: bZIP; Clone source: Jolma et al. 2013, Ensembl ID: ENSG00000167074; Construct type: TF2(3xFLAG); TF family: bZIP; Clone source: Jolma et al. 2013
Length: 95
Pfam Domains:     24-77 Basic region leucine zipper
    25-84 bZIP transcription factor
Sequence: 
(in bold interface residues)		   1 MAEDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFL   60
  61 EKENTALRTEVAELRKEVGKCKTIVSKYETKYGPL
Interface Residues: 24, 25, 31, 32, 35, 36, 38, 39, 40, 41, 42, 43, 45
3D-footprint Homologues: 8him_B, 2wt7_A, 1nwq_C, 6mg1_B
Binding Motifs: TEF_DBD yrTTACrTAAym
ATF4_TEF rkmTGAYGCAATm
ELK1_TEF rcCGGAaGTKACGTAAb
ETV2_TEF_1 rCCGGAwrTTACGTAAy
ETV2_TEF_2 TTACGTAAccmmgwACCGGAAry
GCM2_TEF rTrsGGGykgrTTAyRTAA
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]


Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.