Transcription Factor
| Accessions: | FEV_HUMAN (HOCOMOCO 10), Q99581 (JASPAR 2024) |
| Names: | FEV_HUMAN, Fifth Ewing variant protein, PC12 ETS domain-containing transcription factor 1, PC12 ETS factor 1, Pet-1, Protein FEV |
| Organisms: | Homo sapiens, Rattus norvegicus |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Length: | 238 |
| Pfam Domains: | 46-128 Ets-domain |
| Sequence: (in bold interface residues) | 1 MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR 60 61 ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK 120 121 RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL 180 181 MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH |
| Interface Residues: | 44, 99, 100, 102, 103, 104, 106, 107, 121 |
| 3D-footprint Homologues: | 3zp5_A, 4mhg_A, 8smh_F, 4uno_A, 2stt_A, 8smj_F, 7jsa_J, 3jtg_A, 1dux_F, 8ee9_F, 1yo5_C, 4iri_A, 1awc_A, 4l18_B, 1bc8_C, 4lg0_B |
| Binding Motifs: | MA0156.1 CAGGAArT MA0156.2 aCCGGAArTr FEV_HUMAN.H10MO.C|M01135 CAGGAArTdm MA0156.3 rACCGGAAGTgr MA0156.4 ACCGGAAGT |
| Binding Sites: | MA0156.1.1 MA0156.1.10 MA0156.1.11 MA0156.1.12 MA0156.1.13 MA0156.1.2 MA0156.1.3 MA0156.1.4 MA0156.1.5 MA0156.1.6 MA0156.1.7 MA0156.1.8 MA0156.1.9 |
| Publications: | Portales-Casamar E, Kirov S, Lim J, Lithwick S, Swanson M.I, Ticoll A, Snoddy J, Wasserman W.W. PAZAR: a framework for collection and dissemination of cis-regulatory sequence annotation. Genome biology 8:R207 (2007). [Pubmed] Wei G-H, Badis G, Berger MF, Kivioja T, Palin K, Enge M, Bonke M, Jolma A, Varjosalo M, Gehrke AR, Yan J, Talukder S, Turunen M, Taipale M, Stunnenberg HG, Ukkonen E, Hughes TR, Bulyk ML, Taipale J. Genome-wide analysis of ETS family DNA-binding in vitro and in vivo. The EMBO Journal. Epub 2010 Jun 1. doi:10.1038/emboj.2010.106 [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.