Transcription Factor
| Accessions: | T000694_1.02 (CISBP 1.02), Q9LSX0 (JASPAR 2024), 5wx9_A (3D-footprint 20231221) |
| Names: | AT5G43410, T000694_1.02;, ERF96_ARATH, Ethylene-responsive transcription factor ERF096 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2, 3D-footprint 20231221 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Notes: | experiment type:PBM, family:AP2 |
| Length: | 131 |
| Pfam Domains: | 14-64 AP2 domain |
| Sequence: (in bold interface residues) | 1 MDQGGRGVGAEHGKYRGVRRRPWGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAY 60 61 SMRGQAAILNFPHEYNMGSGVSSSTAMAGSSSASASASSSSRQVFEFEYLDDSVLEELLE 120 121 EGEKPNKGKKK |
| Interface Residues: | 3, 19, 21, 22, 23, 27, 29, 31, 36, 39, 41 |
| 3D-footprint Homologues: | 5wx9_A, 7wq5_A, 1gcc_A, 7et4_D |
| Binding Motifs: | M0037_1.02 smGCCGcCay MA0998.1 smGCCGcCay 5wx9_A CTGGcGGCTa MA0998.2 GCCGcC |
| Binding Sites: | 5wx9_B 5wx9_C |
| Publications: | Hao D., Ohme-Takagi M., Sarai A. Unique mode of GCC box recognition by the DNA-binding domain of ethylene-responsive element-binding factor (ERF domain) in plant. J. Biol. Chem. 273:26857-26861 (1998). [Pubmed] Chen CY, Lin PH, Chen KH, Cheng YS. Structural insights into Arabidopsis ethylene response factor 96 with an extended N-terminal binding to GCC box. Plant Mol Biol : (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.