Transcription Factor

Accessions: 5jh0_D (3D-footprint 20250804)
Names: ABF2_YEAST, ARS-binding factor 2, mitochondrial
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02486
Length: 157
Pfam Domains: 19-86 HMG (high mobility group) box
19-81 Domain of unknown function (DUF1898)
92-157 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 HHKASKRTQLRNELIKQGPKRPTSAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKWQNL 60
61 EADIKEKYISERKKLYSEYQKAKKEFDEKLPPKKPAGPFIKYANEVRSQVFAQHPDKSQL 120
121 DLMKIIGDKWQSLDQSIKDKYIQEYKKAIQEYNARYP
Interface Residues: 21, 24, 26, 27, 30, 34, 45, 46, 47, 50, 81, 84, 94, 97, 99, 100, 103, 107, 118, 119, 120, 123
3D-footprint Homologues: 7m5w_A, 2gzk_A, 3u2b_C, 1j5n_A, 4s2q_D, 1o4x_B, 3f27_D, 4y60_C, 1qrv_A, 1hry_A, 1ckt_A, 2lef_A, 3tmm_A
Binding Motifs: 5jh0_AD AATAnnnnnnnATATAATAnnnAATAnnnnnnnnTATaAT
5jh0_D ATATaATAnnnAATA
Publications: Chakraborty A, Lyonnais S, Battistini F, Hospital A, Medici G, Prohens R, Orozco M, Vilardell J, Solà M. DNA structure directs positioning of the mitochondrial genome packaging protein Abf2p. Nucleic Acids Res 45:951-967 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.