Transcription Factor
Accessions: | 1puf_A (3D-footprint 20241219) |
Names: | Homeobox protein Hox-1.7, Homeobox protein Hox-A9, HXA9_MOUSE |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P09631 |
Length: | 77 |
Pfam Domains: | 14-70 Homeobox domain |
Sequence: (in bold interface residues) | 1 NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIW 60 61 FQNRRMKMKKINKDRAK |
Interface Residues: | 14, 15, 16, 17, 55, 56, 58, 59, 62, 63, 65, 66, 67, 68, 70 |
3D-footprint Homologues: | 8ejp_B, 6m3d_C, 8pmf_A, 1zq3_P, 2lkx_A, 7q3o_C, 6es3_K, 2ld5_A, 8ik5_C, 2hos_A, 8osb_E, 8eml_B, 7psx_B, 2hdd_A, 9b8u_A, 4cyc_A, 7xrc_C, 8g87_X, 8bx1_A, 7vru_B |
Binding Motifs: | 1puf_A tTACnaC 1puf_AB ATGATwTACnAC |
Binding Sites: | 1puf_D 1puf_E |
Publications: | LaRonde-LeBlanc N.A, Wolberger C. Structure of HoxA9 and Pbx1 bound to DNA: Hox hexapeptide and DNA recognition anterior to posterior. Genes & development 17:2060-72 (2003). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.