Transcription Factor

Accessions: 1puf_A (3D-footprint 20250804)
Names: Homeobox protein Hox-1.7, Homeobox protein Hox-A9, HXA9_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P09631
Length: 77
Pfam Domains: 14-70 Homeobox domain
Sequence:
(in bold interface residues)
1 NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIW 60
61 FQNRRMKMKKINKDRAK
Interface Residues: 14, 15, 16, 17, 55, 56, 58, 59, 62, 63, 65, 66, 67, 68, 70
3D-footprint Homologues: 1fjl_B, 8pmf_A, 1ig7_A, 5zfz_A, 6m3d_C, 3cmy_A, 1puf_A, 3d1n_M, 8ejp_B, 6a8r_A, 1nk2_P, 1zq3_P, 2lkx_A, 7q3o_C, 2ld5_A, 6es3_K, 1puf_B, 8osb_E, 5jlw_D, 3lnq_A, 8eml_B, 1b72_A, 4xrs_G, 3a01_E, 3rkq_B, 5flv_I, 2hdd_A, 9b8u_A, 1jgg_B, 5zjt_E, 4cyc_A, 2r5y_A, 8ik5_C, 7psx_B, 5hod_A, 2hos_A, 2xsd_C, 7xrc_C, 1e3o_C, 1le8_A, 1au7_A, 4qtr_D, 1o4x_A, 8g87_X, 1du0_A, 8bx1_A
Binding Motifs: 1puf_A tTACnaC
1puf_AB ATGATwTACnAC
Binding Sites: 1puf_D
1puf_E
Publications: LaRonde-LeBlanc N.A, Wolberger C. Structure of HoxA9 and Pbx1 bound to DNA: Hox hexapeptide and DNA recognition anterior to posterior. Genes & development 17:2060-72 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.