Transcription Factor

						

			
Accessions: 6mg2_A (3D-footprint 20231221)

			
Names: C/EBP beta, CCAAT/enhancer-binding protein beta, CEBPB_HUMAN, LAP, LIP, Liver activator protein, Liver-enriched inhibitory protein, Nuclear factor NF-IL6, TCF-5, Transcription factor 5
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P17676
Length: 65
Pfam Domains:      3-56 Basic region leucine zipper
     4-62 bZIP transcription factor
Sequence: 
(in bold interface residues)		   1 MKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTL   60
  61 RNLFK
Interface Residues: 10, 11, 14, 15, 17, 18, 21, 22
3D-footprint Homologues: 2wt7_A, 1nwq_C, 6mg1_B, 2c9l_Z, 2dgc_A
Binding Motifs: 6mg2_AB ATTGCGnAAT
			
Publications: Yang J, Horton JR, Wang D, Ren R, Li J, Sun D, Huang Y, Zhang X, Blumenthal RM, Cheng X. Structural basis for effects of CpA modifications on C/EBPβ binding of DNA. Nucleic Acids Res : (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.