Transcription Factor

Accessions: 1oct_C (3D-footprint 20241219)
Names: NF-A1, OCT-1 POU DOMAIN, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P14859
Length: 131
Pfam Domains: 1-71 Pou domain - N-terminal to homeobox domain
72-128 Homeobox domain
Sequence:
(in bold interface residues)
1 DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLK 60
61 PLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFC 120
121 NRRQKEKRINP
Interface Residues: 23, 39, 40, 41, 42, 44, 45, 51, 55, 72, 73, 74, 75, 113, 114, 116, 117, 120, 121, 123, 124, 125, 128
3D-footprint Homologues: 7u0g_M, 8bx1_A, 7xzx_N, 7xzz_N, 8g87_X, 7xrc_C, 8ejp_B, 8pmf_A, 1zq3_P, 6m3d_C, 2lkx_A, 7q3o_C, 6es3_K, 2hdd_A, 8eml_B, 2hos_A, 8ik5_C, 2ld5_A, 8osb_E, 7psx_B, 4cyc_A, 9b8u_A, 2d5v_B
Binding Motifs: 1oct_C TATGCAAA
Binding Sites: 1oct_A
1oct_B
Publications: Klemm J. D., Rould M. A., Aurora R., Herr W., Pabo C. O. Crytsal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules. Cell 77:21-32 (1994). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.