Transcription Factor
| Accessions: | 1oct_C (3D-footprint 20231221) |
| Names: | NF-A1, OCT-1 POU DOMAIN, Octamer-binding protein 1, Octamer-binding transcription factor 1, OTF-1, PO2F1_HUMAN, POU domain, class 2, transcription factor 1 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P14859 |
| Length: | 131 |
| Pfam Domains: | 1-71 Pou domain - N-terminal to homeobox domain 72-128 Homeobox domain |
| Sequence: (in bold interface residues) | 1 DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLK 60 61 PLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFC 120 121 NRRQKEKRINP |
| Interface Residues: | 23, 39, 40, 41, 42, 44, 45, 51, 55, 63, 72, 73, 74, 75, 79, 80, 83, 84, 113, 114, 116, 117, 120, 121, 124, 125, 128 |
| 3D-footprint Homologues: | 7u0g_M, 3d1n_M, 3l1p_A, 7xrc_C, 2xsd_C, 1o4x_A, 8g87_X, 1e3o_C, 1au7_A, 1lq1_D, 3cmy_A, 5zfz_A, 2r5y_A, 1ig7_A, 6a8r_A, 2h1k_B, 1puf_A, 1fjl_B, 1zq3_P, 6m3d_C, 1nk2_P, 2lkx_A, 7q3o_C, 6es3_K, 4xrs_G, 2hdd_A, 1b72_A, 2hos_A, 5zjt_E, 5hod_A, 3a01_E, 2ld5_A, 5jlw_D, 1le8_A, 3rkq_B, 5flv_I, 1du0_A, 4cyc_A, 2d5v_B, 1jgg_B, 7psx_B, 4qtr_D, 3lnq_A |
| Binding Motifs: | 1oct_C TATGCAAA |
| Binding Sites: | 1oct_A 1oct_B |
| Publications: | Klemm J. D., Rould M. A., Aurora R., Herr W., Pabo C. O. Crytsal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules. Cell 77:21-32 (1994). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.