Transcription Factor
| Accessions: | 1mey_C (3D-footprint 20250804) |
| Names: | CONSENSUS ZINC FINGER |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 83 |
| Pfam Domains: | 1-14 Zinc-finger double domain 3-26 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 4-26 C2H2-type zinc finger 18-42 Zinc-finger double domain 31-54 C2H2-type zinc finger 32-54 C2H2-type zinc finger 32-54 Zinc finger, C2H2 type 46-71 Zinc-finger double domain 59-82 C2H2-type zinc finger 60-82 C2H2-type zinc finger 60-82 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPY 60 61 KCPECGKSFSRSDHLSRHQRTHQ |
| Interface Residues: | 1, 4, 14, 15, 16, 17, 18, 20, 21, 25, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 70, 71, 72, 73, 74, 75, 76, 77, 78 |
| 3D-footprint Homologues: | 1yuj_A, 2kmk_A, 1tf3_A, 6ml4_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 7ysf_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 5yel_A, 4x9j_A, 2gli_A, 8ssu_A, 1g2f_F, 5kkq_D, 1ubd_C, 5ei9_F, 2jpa_A, 5kl3_A, 5v3j_F, 8h9h_G, 2lt7_A, 1tf6_A, 6e94_A, 7y3m_I, 6a57_A, 2drp_D, 1f2i_J, 2wbs_A, 8gn3_A, 1llm_D, 7txc_E, 4m9v_C, 5yj3_D |
| Binding Motifs: | 1mey_C GrGGCAGAAy 1mey_CF GGGGCAGAACnnTGAGGCAGAAC |
| Binding Sites: | 1mey_A 1mey_B |
| Publications: | Kim C.A, Berg J.M. A 2.2 A resolution crystal structure of a designed zinc finger protein bound to DNA. Nature structural biology 3:940-5 (1996). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.