Transcription Factor

Accessions: 1mey_C (3D-footprint 20250804)
Names: CONSENSUS ZINC FINGER
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 83
Pfam Domains: 1-14 Zinc-finger double domain
3-26 C2H2-type zinc finger
4-26 Zinc finger, C2H2 type
4-26 C2H2-type zinc finger
18-42 Zinc-finger double domain
31-54 C2H2-type zinc finger
32-54 C2H2-type zinc finger
32-54 Zinc finger, C2H2 type
46-71 Zinc-finger double domain
59-82 C2H2-type zinc finger
60-82 C2H2-type zinc finger
60-82 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHTGEKPY 60
61 KCPECGKSFSRSDHLSRHQRTHQ
Interface Residues: 1, 4, 14, 15, 16, 17, 18, 20, 21, 25, 42, 43, 44, 45, 46, 47, 48, 49, 50, 53, 70, 71, 72, 73, 74, 75, 76, 77, 78
3D-footprint Homologues: 1yuj_A, 2kmk_A, 1tf3_A, 6ml4_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 7ysf_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 5yel_A, 4x9j_A, 2gli_A, 8ssu_A, 1g2f_F, 5kkq_D, 1ubd_C, 5ei9_F, 2jpa_A, 5kl3_A, 5v3j_F, 8h9h_G, 2lt7_A, 1tf6_A, 6e94_A, 7y3m_I, 6a57_A, 2drp_D, 1f2i_J, 2wbs_A, 8gn3_A, 1llm_D, 7txc_E, 4m9v_C, 5yj3_D
Binding Motifs: 1mey_C GrGGCAGAAy
1mey_CF GGGGCAGAACnnTGAGGCAGAAC
Binding Sites: 1mey_A
1mey_B
Publications: Kim C.A, Berg J.M. A 2.2 A resolution crystal structure of a designed zinc finger protein bound to DNA. Nature structural biology 3:940-5 (1996). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.