Transcription Factor
| Accessions: | 4roc_B (3D-footprint 20250804), 5n9g_B (3D-footprint 20250804), 5n9g_G (3D-footprint 20250804) |
| Names: | TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P20226 |
| Length: | 178 |
| Pfam Domains: | 7-89 Transcription factor TFIID (or TATA-binding protein, TBP) 95-177 Transcription factor TFIID (or TATA-binding protein, TBP) |
| Sequence: (in bold interface residues) | 1 GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSS 60 61 GKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLT 120 121 HQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG |
| Interface Residues: | 11, 13, 41, 42, 56, 58, 64, 66, 100, 101, 103, 132, 133, 147, 149, 155, 157 |
| 3D-footprint Homologues: | 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A, 5iy6_P |
| Binding Motifs: | 4roc_AB GGnnTTAAAATAnGT 4roc_B TTAAAATA 5n9g_ABC gnnnnannTATTTTAAnnC 5n9g_FGH gnnTTAAAATAnnt |
| Binding Sites: | 4roc_N 4roc_T 5n9g_D / 5n9g_I 5n9g_E / 5n9g_J 5n9g_a 5n9g_b |
| Publications: | Gouge J, Satia K, Guthertz N, Widya M, Thompson AJ, Cousin P, Dergai O, Hernandez N, Vannini A. Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2. Cell 163:1375-87 (2015). [Pubmed] Gouge J, Guthertz N, Kramm K, Dergai O, Abascal-Palacios G, Satia K, Cousin P, Hernandez N, Grohmann D, Vannini A. Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation. Nat Commun 8:130 (2017). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.