Transcription Factor

Accessions: 4roc_B (3D-footprint 20260701), 5n9g_B (3D-footprint 20260701), 5n9g_G (3D-footprint 20260701)
Names: TATA sequence-binding protein, TATA-binding factor, TATA-box factor, TATA-box-binding protein, TBP_HUMAN, Transcription initiation factor TFIID TBP subunit
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20226
Length: 178
Pfam Domains: 7-89 Transcription factor TFIID (or TATA-binding protein, TBP)
95-177 Transcription factor TFIID (or TATA-binding protein, TBP)
Sequence:
(in bold interface residues)
1 GPSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSS 60
61 GKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLT 120
121 HQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Interface Residues: 11, 13, 41, 42, 56, 58, 64, 66, 100, 101, 103, 132, 133, 147, 149, 155, 157
3D-footprint Homologues: 5iy6_P, 7z7n_D, 1qna_B, 5n9g_G, 1ytb_A, 5oqj_O, 1ais_A, 4wzs_D, 6cnb_R, 1cdw_A
Binding Motifs: 4roc_AB GGnnTTAAAATAnGT
4roc_B TTAAAATA
5n9g_ABC gnnnnannTATTTTAAnnC
5n9g_FGH gnnTTAAAATAnnt
Binding Sites: 4roc_N
4roc_T
5n9g_D / 5n9g_I
5n9g_E / 5n9g_J
5n9g_a
5n9g_b
Publications: Gouge J, Satia K, Guthertz N, Widya M, Thompson AJ, Cousin P, Dergai O, Hernandez N, Vannini A. Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2. Cell 163:1375-87 (2015). [Pubmed]

Gouge J, Guthertz N, Kramm K, Dergai O, Abascal-Palacios G, Satia K, Cousin P, Hernandez N, Grohmann D, Vannini A. Molecular mechanisms of Bdp1 in TFIIIB assembly and RNA polymerase III transcription initiation. Nat Commun 8:130 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.