Transcription Factor
| Accessions: | SP3_DBD (HumanTF 1.0) |
| Names: | SP3, SP3_HUMAN, SPR-2, Transcription factor Sp3 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | Q02447 |
| Notes: | Ensembl ID: ENSG00000172845; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman |
| Length: | 126 |
| Pfam Domains: | 20-44 C2H2-type zinc finger 20-44 Zinc finger, C2H2 type 36-63 Zinc-finger double domain 50-74 C2H2-type zinc finger 50-74 Zinc finger, C2H2 type 67-89 Zinc-finger double domain 80-102 C2H2-type zinc finger 80-102 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MANCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKR 60 61 FTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEA 120 121 ARDDTL |
| Interface Residues: | 10, 12, 16, 32, 33, 34, 35, 36, 38, 39, 41, 42, 45, 61, 62, 63, 64, 65, 66, 68, 69, 70, 73, 90, 91, 92, 93, 94, 95, 96, 97, 98, 101, 122, 123, 124, 125 |
| 3D-footprint Homologues: | 7w1m_H, 5yel_A, 6ml4_A, 1tf3_A, 7n5w_A, 6jnm_A, 2kmk_A, 1llm_D, 7ysf_A, 8ssq_A, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 5k5i_A, 8h9h_G, 2lt7_A, 6e94_A, 7y3m_I, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 2drp_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C, 5v3j_F, 5yj3_D |
| Binding Motifs: | SP3_DBD sCCACrCCCmc |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.