Transcription Factor

						

			
Accessions: SP3_DBD (HumanTF 1.0)

			
Names: SP3, SP3_HUMAN, SPR-2, Transcription factor Sp3
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q02447
Notes: Ensembl ID: ENSG00000172845; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman
Length: 126
Pfam Domains:     20-44 Zinc finger, C2H2 type
    20-44 C2H2-type zinc finger
    36-63 Zinc-finger double domain
    50-74 Zinc finger, C2H2 type
    50-74 C2H2-type zinc finger
    67-89 Zinc-finger double domain
   80-102 C2H2-type zinc finger
   80-102 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 MANCKEGGGRGTNLGKKKQHICHIPGCGKVYGKTSHLRAHLRWHSGERPFVCNWMYCGKR   60
  61 FTRSDELQRHRRTHTGEKKFVCPECSKRFMRSDHLAKHIKTHQNKKGIHSSSTVLASVEA  120
 121 ARDDTL
Interface Residues: 10, 12, 16, 32, 33, 34, 35, 36, 38, 39, 41, 42, 45, 61, 62, 63, 64, 65, 66, 68, 69, 70, 73, 90, 91, 92, 93, 94, 95, 96, 97, 98, 101, 122, 123, 124, 125
3D-footprint Homologues: 7w1m_H, 5yel_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 5k5i_A, 2kmk_A, 1llm_D, 7ysf_A, 8ssq_A, 6blw_A, 5k5l_F, 8h9h_G, 6e94_A, 7y3m_I, 2lt7_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 1f2i_J, 2wbs_A, 7txc_E, 2drp_D, 4m9v_C, 5yj3_D, 5v3j_F
Binding Motifs: SP3_DBD sCCACrCCCmc
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.