Transcription Factor
| Accessions: | 4omy_A (3D-footprint 20231221), 4omy_B (3D-footprint 20231221), 4omy_C (3D-footprint 20231221), 4omy_D (3D-footprint 20231221), 4on0_A (3D-footprint 20231221), 4on0_B (3D-footprint 20231221), 4on0_C (3D-footprint 20231221), 4on0_D (3D-footprint 20231221) |
| Names: | NolR, Q83TD2_RHIFR |
| Organisms: | Sinorhizobium fredii |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q83TD2 |
| Length: | 97 |
| Pfam Domains: | 18-72 Helix-turn-helix domain 23-69 Bacterial regulatory protein, arsR family 24-67 Winged helix-turn-helix DNA-binding 24-72 MarR family |
| Sequence: (in bold interface residues) | 1 QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSK 60 61 LRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG |
| Interface Residues: | 50, 51, 52, 53, 55, 56, 64, 71, 73, 74 |
| 3D-footprint Homologues: | 2h8r_B, 4hf1_A, 4on0_B, 1ic8_B |
| Binding Motifs: | 4omy_A CTAA 4omy_AB TnTCAGnnnnnnCTAa 4omy_CD AannTCAGnnnnnnCTmA 4on0_AB TAnCATCAGnnnnnnCTAA 4on0_B CTGATGntA 4on0_CD TTAGnnnnnnCTkaTG |
| Binding Sites: | 4omy_E / 4omy_G 4omy_F / 4omy_H 4on0_E / 4on0_G 4on0_F / 4on0_H |
| Publications: | Lee S.G, Krishnan H.B, Jez J.M. Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR. Proceedings of the National Academy of Sciences of the United States of America 111:6509-14 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.