Transcription Factor

Accessions: 4omy_A (3D-footprint 20260701), 4omy_B (3D-footprint 20260701), 4omy_C (3D-footprint 20260701), 4omy_D (3D-footprint 20260701), 4on0_A (3D-footprint 20260701), 4on0_B (3D-footprint 20260701), 4on0_C (3D-footprint 20260701), 4on0_D (3D-footprint 20260701)
Names: NolR, Q83TD2_RHIFR
Organisms: Sinorhizobium fredii
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q83TD2
Length: 97
Pfam Domains: 18-72 Helix-turn-helix domain
23-69 Bacterial regulatory protein, arsR family
24-67 Winged helix-turn-helix DNA-binding
24-72 MarR family
Sequence:
(in bold interface residues)
1 QPLSPEKHEEAEIAAGFLSAMANPKRLLILDSLVKEEMAVGALANKVGLSQSALSQHLSK 60
61 LRAQNLVSTRRDAQTIYYSSSSDSVMKILGALSEIYG
Interface Residues: 50, 51, 52, 53, 55, 56, 64, 71, 73, 74
3D-footprint Homologues: 4hf1_A, 4on0_B, 8pi8_B, 2h8r_B
Binding Motifs: 4omy_A CTAA
4omy_AB TnTCAGnnnnnnCTAa
4omy_CD AannTCAGnnnnnnCTmA
4on0_AB TAnCATCAGnnnnnnCTAA
4on0_B CTGATGntA
4on0_CD TTAGnnnnnnCTkaTG
Binding Sites: 4omy_E / 4omy_G
4omy_F / 4omy_H
4on0_E / 4on0_G
4on0_F / 4on0_H
Publications: Lee S.G, Krishnan H.B, Jez J.M. Structural basis for regulation of rhizobial nodulation and symbiosis gene expression by the regulatory protein NolR. Proceedings of the National Academy of Sciences of the United States of America 111:6509-14 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.