Transcription Factor

Accessions: 3qsv_D (3D-footprint 20231221)
Names: Deletion target in pancreatic carcinoma 4 homolog, MAD homolog 4, Mothers against decapentaplegic homolog 4, Mothers against DPP homolog 4, SMAD 4, SMAD family member 4, SMAD4_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P97471
Length: 125
Pfam Domains: 26-125 MH1 domain
Sequence:
(in bold interface residues)
1 SNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKC 60
61 VTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPY 120
121 HYERV
Interface Residues: 68, 70, 72, 77, 104, 106
3D-footprint Homologues: 6fzs_A, 6h3r_A, 5nm9_A, 5od6_A, 5mey_A, 7qd4_A
Binding Motifs: 3qsv_AD GkCTAGrC
Binding Sites: 3qsv_E / 3qsv_F
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.