Transcription Factor
| Accessions: | Q9LFU3 (JASPAR 2024), T26338 (AthalianaCistrome v4_May2016), bZIP3 (EEADannot 2023-12-22) |
| Names: | At5g15830, Basic leucine-zipper 3, BZIP DNA-binding protein-like, Putative bZIP transcription factor AtbZip3, Q9LFU3_ARATH, bZIP3, T26338;, Q9LFU3_ARATH;At5g15830 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | JASPAR 2024 1, AthalianaCistrome v4_May2016 2, EEADannot 2023-12-22 3 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 3 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | ecotype:Col-0, experiment type: DAP-seq, family:bZIP |
| Length: | 186 |
| Pfam Domains: | 72-121 Basic region leucine zipper 74-124 bZIP transcription factor |
| Sequence: (in bold interface residues) | 1 MQPNYDSSSLNNMQQQDYFNLNNYYNNLNPSTNNNNLNILQYPQIQELNLQSPVSNNSTT 60 61 SDDATEEIFVINERKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQ 120 121 VSDNNDLVIQENSSLKEENLELRQVITSMKKLGGGIHDKYSSPSSMDELDQDFSSITDDP 180 181 RTHHPS |
| Interface Residues: | 78, 81, 82, 83, 85, 86, 89, 90 |
| 3D-footprint Homologues: | 1gd2_G, 4eot_A, 2dgc_A |
| Binding Motifs: | M0194 / MA1340.1 dwwGmTGACGTGGCa EEAD0132 GmTGACGTGGC EEAD0133 kmCACGTGkCa MA1340.2 wGmTGACGTGGCa |
| Binding Sites: | MA1340.1.1 MA1340.1.9 MA1340.1.11 MA1340.1.13 MA1340.1.16 MA1340.1.20 MA1340.1.3 MA1340.1.4 MA1340.1.2 MA1340.1.5 MA1340.1.8 MA1340.1.7 MA1340.1.6 MA1340.1.10 MA1340.1.12 MA1340.1.14 MA1340.1.15 MA1340.1.17 MA1340.1.18 MA1340.1.19 MA1340.2.13 MA1340.2.20 MA1340.2.16 MA1340.2.10 MA1340.2.9 MA1340.2.1 MA1340.2.11 MA1340.2.3 MA1340.2.2 MA1340.2.8 MA1340.2.4 MA1340.2.5 MA1340.2.7 MA1340.2.6 MA1340.2.12 MA1340.2.14 MA1340.2.15 MA1340.2.17 MA1340.2.18 MA1340.2.19 |
| Publications: | Izawa T., Foster R., Chua N.-H. Plant bZIP protein DNA binding specificity.. J. Mol. Biol. 230:1131-1144 (1993). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.