Transcription Factor

						

			
Accessions: 5xxp_A (3D-footprint 20231221), 5xxp_B (3D-footprint 20231221)

			
Names: LysR-type regulatory protein, Q9WXC7_CUPNE
Organisms: Cupriavidus necator, Cupriavidus necator (Alcaligenes eutrophus)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 87
Pfam Domains:      3-62 Bacterial regulatory helix-turn-helix protein, lysR family
Sequence: 
(in bold interface residues)		   1 MEFRQLKYFIAVAEAGNMAAAAKRLHVSQPPITRQMQALEADLGVVLLERSHRGIELTAA   60
  61 GHAFLEDARRILELAGRSGDRSRAAAR
Interface Residues: 28, 29, 30, 31, 33, 34, 52, 53
3D-footprint Homologues: 7d98_Q, 4iht_D, 5xxp_A
Binding Motifs: 5xxp_A CGTAAnnnTG
5xxp_AB TtACgnnnnncGTAAnnnT
Binding Sites: 5xxp_E
5xxp_F
			
Publications: Koentjoro MP, Adachi N, Senda M, Ogawa N, Senda T. Crystal structure of the DNA-binding domain of the LysR-type transcriptional regulator CbnR in complex with a DNA fragment of the recognition-binding site in the promoter region. FEBS J 285:977-989 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.