Transcription Factor

Accessions: SCRT1_DBD (HumanTF 1.0), SCRT1 (HT-SELEX2 May2017)
Names: hScrt, Scratch homolog 1 zinc finger protein, SCRT1, SCRT1_HUMAN, Transcriptional repressor scratch 1, ENSG00000170616
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q9BWW7
Notes: Ensembl ID: ENSG00000170616; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2
Length: 174
Pfam Domains: 19-41 C2H2-type zinc finger
19-41 Zinc finger, C2H2 type
19-43 C2H2-type zinc finger
50-64 C2H2-type zinc finger
51-72 C2H2-type zinc finger
76-98 C2H2-type zinc finger
76-98 C2H2-type zinc finger
76-98 Zinc finger, C2H2 type
77-98 Zinc-finger of C2H2 type
91-114 Zinc-finger double domain
104-126 C2H2-type zinc finger
105-126 Zinc finger, C2H2 type
106-126 C2H2-type zinc finger
118-142 Zinc-finger double domain
132-146 C2H2-type zinc finger
132-153 C2H2-type zinc finger
132-153 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 GAGTEARAGPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYV 60
61 SMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLR 120
121 AHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPV
Interface Residues: 29, 30, 32, 33, 36, 60, 61, 62, 63, 64, 66, 67, 68, 69, 70, 86, 87, 88, 89, 90, 93, 94, 114, 115, 116, 117, 118, 119, 120, 121, 122, 125, 142, 143, 144, 145, 146, 148, 149
3D-footprint Homologues: 7w1m_H, 5ei9_F, 5yel_A, 7n5w_A, 6jnm_A, 8ssu_A, 5kkq_D, 2kmk_A, 6ml4_A, 2drp_D, 8ssq_A, 5k5l_F, 8h9h_G, 7ysf_A, 2lt7_A, 6a57_A, 2gli_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1f2i_J, 1tf6_A, 8gn3_A, 1g2f_F, 5kl3_A, 7txc_E, 5k5i_A, 1llm_D, 5v3j_F, 6blw_A, 6u9q_A, 4x9j_A, 4m9v_C, 6e94_A, 7y3m_I, 2wbs_A, 5yj3_D
Binding Motifs: SCRT1_DBD rwKCAACAGGTGkty
SCRT1_2 hKCAACAGGTg
SCRT1_methyl_1 wGCrACAGGTg
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.