Transcription Factor
| Accessions: | SCRT1_DBD (HumanTF 1.0), SCRT1 (HT-SELEX2 May2017) |
| Names: | hScrt, Scratch homolog 1 zinc finger protein, SCRT1, SCRT1_HUMAN, Transcriptional repressor scratch 1, ENSG00000170616 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q9BWW7 |
| Notes: | Ensembl ID: ENSG00000170616; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 174 |
| Pfam Domains: | 19-41 C2H2-type zinc finger 19-41 Zinc finger, C2H2 type 19-43 C2H2-type zinc finger 50-64 C2H2-type zinc finger 51-72 C2H2-type zinc finger 76-98 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type 76-98 C2H2-type zinc finger 77-98 Zinc-finger of C2H2 type 91-114 Zinc-finger double domain 104-126 C2H2-type zinc finger 105-126 Zinc finger, C2H2 type 106-126 C2H2-type zinc finger 118-142 Zinc-finger double domain 132-146 C2H2-type zinc finger 132-153 Zinc finger, C2H2 type 132-153 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 GAGTEARAGPGAAGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYV 60 61 SMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLR 120 121 AHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESACFKGGAGGPAAPAPPQLSPV |
| Interface Residues: | 29, 30, 32, 33, 36, 60, 61, 62, 63, 64, 66, 67, 68, 69, 70, 86, 87, 88, 89, 90, 93, 94, 114, 115, 116, 117, 118, 119, 120, 121, 122, 125, 142, 143, 144, 145, 146, 148, 149 |
| 3D-footprint Homologues: | 7w1m_H, 5yel_A, 5ei9_F, 7n5w_A, 6jnm_A, 5k5l_F, 8ssu_A, 5kkq_D, 2kmk_A, 6ml4_A, 2drp_D, 8ssq_A, 8h9h_G, 2lt7_A, 7ysf_A, 6a57_A, 2gli_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 6blw_A, 6u9q_A, 4x9j_A, 1f2i_J, 1tf6_A, 8gn3_A, 1g2f_F, 5kl3_A, 7txc_E, 5k5i_A, 1llm_D, 5v3j_F, 4m9v_C, 6e94_A, 7y3m_I, 2wbs_A, 5yj3_D |
| Binding Motifs: | SCRT1_DBD rwKCAACAGGTGkty SCRT1_2 hKCAACAGGTg SCRT1_methyl_1 wGCrACAGGTg |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.