Transcription Factor

Accessions: T100220_1.02 (CISBP 1.02), G5EEA1 (JASPAR 2024)
Names: lim-4, T100220_1.02;, G5EEA1_CAEEL, LIM domain family, LIM4_CAEEL, Putative transcription factor LIM-4
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 355
Pfam Domains: 98-152 LIM domain
168-224 LIM domain
240-296 Homeobox domain
Sequence:
(in bold interface residues)
1 MDAHLVQAKKTSTASELSDSSLTFPFIGDYLSSPSLTTSDYVSDCSNLTVEGPVPANQEF 60
61 SSSDESSVYISSALRLADYAFTPDDNIRIKPDAVIVICTQCQHQIQDKFFLSIDGRNYHE 120
121 NCLQCSTCENPLSNKCFYKDKTFYCKGCYFRTHVTSTASSCRELGPKCASCDRTIQATDW 180
181 VRRARNYVYHLACFSCNQCKRQLSTGEEYALQEGNLLCKQHFLELVEGDSGVSSQKAKTK 240
241 RVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQK 300
301 SEGDNGDSQRSSVGPSSPSQKSDSSSEMMYPTSVTTSVEDAIPDSIVILGSLQFD
Interface Residues: 177, 179, 180, 183, 204, 205, 208, 240, 241, 242, 243, 281, 282, 284, 285, 288, 289, 292, 293, 296, 307, 310
3D-footprint Homologues: 7ysf_A, 1fjl_B, 6a8r_A, 3cmy_A, 2h1k_B, 1ig7_A, 3d1n_M, 5zfz_A, 6m3d_C, 1zq3_P, 3lnq_A, 1nk2_P, 2lkx_A, 1jgg_B, 2ld5_A, 5flv_I, 3l1p_A, 2hos_A, 1au7_A, 4j19_B, 3a01_E, 7psx_B, 5hod_A, 1b72_A, 3rkq_B, 4xrs_G, 2hdd_A, 4cyc_A, 2r5y_A, 1puf_B, 5jlw_D, 1e3o_C, 1le8_A, 7q3o_C, 5zjt_E, 4qtr_D, 1puf_A, 1du0_A, 6es3_K
Binding Motifs: M1143_1.02 rsYAATTAr
MA0923.1 rsYAATTAr
MA0923.2 YAATTAr
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.