Transcription Factor

Accessions: 5hod_D (3D-footprint 20260701)
Names: LHX4_HUMAN, LIM homeobox protein 4, LIM/homeobox protein Lhx4
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q969G2
Length: 58
Pfam Domains: 1-56 Homeobox domain
13-52 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLK
Interface Residues: 1, 2, 3, 41, 42, 44, 45, 48, 49, 51, 52, 53, 56
3D-footprint Homologues: 3lnq_A, 1jgg_B, 2lkx_A, 6m3d_C, 1zq3_P, 2ld5_A, 1ig7_A, 6ryd_F, 5hod_A, 8pmf_A, 6a8r_A, 3a01_E, 2d5v_B, 5jlw_D, 3rkq_B, 8pop_A, 4xrs_G, 3cmy_A, 2hdd_A, 8ik5_C, 1au7_A, 5zfz_A, 4cyc_A, 2r5y_A, 9b8u_A, 8ejp_B, 1fjl_B, 5flv_I, 3d1n_M, 2hos_A, 8osb_E, 1b72_A, 8eml_B, 7xrc_C, 1e3o_C, 1le8_A, 7q3o_C, 2xsd_C, 1o4x_A, 1du0_A, 4xrm_B, 8g87_X, 6wig_A, 1puf_A, 8bx1_A, 6es3_K, 7psx_B, 1puf_B, 1nk2_P, 5zjt_E, 4qtr_D
Binding Motifs: 5hod_AD CAATnAGnnGTAATna
Binding Sites: 5hod_B
5hod_C
Publications: Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.