Transcription Factor

						

			
Accessions: 6b0o_A (3D-footprint 20231221), 6b0q_A (3D-footprint 20231221)

			
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 119
Pfam Domains:      7-29 C2H2-type zinc finger
    21-48 Zinc-finger double domain
    35-59 Zinc finger, C2H2 type
    35-59 C2H2-type zinc finger
    52-76 Zinc-finger double domain
    65-87 Zinc finger, C2H2 type
    65-87 C2H2-type zinc finger
    65-85 Zinc-finger of C2H2 type
   79-105 Zinc-finger double domain
   93-117 Zinc finger, C2H2 type
   93-115 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHT   60
  61 GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 26, 27, 30, 47, 48, 49, 50, 51, 53, 54, 58, 75, 76, 77, 78, 79, 80, 81, 82, 83, 105, 106, 107, 108, 109, 110, 111, 112, 113
3D-footprint Homologues: 7n5w_A, 6jnm_A, 3uk3_C, 2kmk_A, 8ssu_A, 6ml4_A, 5v3j_F, 6blw_A, 5kkq_D, 6u9q_A, 2i13_A, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 8h9h_G, 7eyi_G, 2lt7_A, 1tf6_A, 7y3m_I, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 1tf3_A, 7y3l_A, 8cuc_F, 5k5i_A, 1g2f_F, 5yel_A, 4x9j_A, 7txc_E, 5kl3_A, 2wbs_A, 1mey_C, 2drp_D, 1f2i_J, 6a57_A, 8gn3_A, 1llm_D, 5yj3_D, 4m9v_C
Binding Motifs: 6b0o_A GCGTGGGAGTGt
6b0q_A GCGTGGGaGt
Binding Sites: 6b0o_B
6b0o_C
6b0q_B
6b0q_C
			
Publications: Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.