Transcription Factor

Accessions: 6b0o_A (3D-footprint 20250804), 6b0q_A (3D-footprint 20250804)
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 119
Pfam Domains: 7-29 C2H2-type zinc finger
21-48 Zinc-finger double domain
35-59 Zinc finger, C2H2 type
35-59 C2H2-type zinc finger
52-76 Zinc-finger double domain
65-87 Zinc finger, C2H2 type
65-87 C2H2-type zinc finger
65-85 Zinc-finger of C2H2 type
79-105 Zinc-finger double domain
93-117 Zinc finger, C2H2 type
93-115 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 HMRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHT 60
61 GVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQR
Interface Residues: 17, 18, 19, 20, 21, 23, 24, 26, 27, 30, 47, 48, 49, 50, 51, 53, 54, 58, 75, 76, 77, 78, 79, 80, 81, 82, 83, 105, 106, 107, 108, 109, 110, 111, 112, 113
3D-footprint Homologues: 6jnm_A, 3uk3_C, 7n5w_A, 5ei9_F, 6ml4_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 8h9h_G, 7y3m_I, 1tf6_A, 7ysf_A, 6e94_A, 2lt7_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7txc_E, 1g2f_F, 5k5i_A, 5yel_A, 2drp_D, 6a57_A, 8gn3_A, 5yj3_D, 1llm_D, 4m9v_C
Binding Motifs: 6b0o_A GCGTGGGAGTGt
6b0q_A GCGTGGGaGt
Binding Sites: 6b0o_B
6b0o_C
6b0q_B
6b0q_C
Publications: Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.