Transcription Factor

Accessions: 6p0t_A (3D-footprint 20231221), 6p0u_A (3D-footprint 20231221)
Names: DNA-binding protein Fis, Factor-for-inversion stimulation protein, FIS_ECOLI, Hin recombinational enhancer-binding protein
Organisms: Escherichia coli, strain K12
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0A6R3
Length: 85
Pfam Domains: 42-82 Bacterial regulatory protein, Fis family
Sequence:
(in bold interface residues)
1 SDVLTVSTVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGN 60
61 QTRAALMMGINRGTLRKKLKKYGMN
Interface Residues: 71, 72, 74, 76, 77
3D-footprint Homologues: 5ds9_A
Binding Motifs: 6p0t_ABE TGTnTTnnnnACAGACTAnA
6p0u_ABEF AnnnnTGTGTTnnnnACMGCC
Publications: Hancock SP, Cascio D, Johnson RC. Cooperative DNA binding by proteins through DNA shape complementarity. Nucleic Acids Res 47:8874-8887 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.