Transcription Factor
Accessions: | Sp1 (FlyZincFinger 1.0 ) |
Names: | CG1343 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 117 |
Pfam Domains: | 31-55 C2H2-type zinc finger 31-55 Zinc finger, C2H2 type 47-74 Zinc-finger double domain 61-85 C2H2-type zinc finger 61-85 Zinc finger, C2H2 type 78-100 Zinc-finger double domain 91-113 Zinc finger, C2H2 type 91-111 Zinc-finger of C2H2 type 91-114 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 YAGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERP 60 61 FVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTA |
Interface Residues: | 17, 18, 20, 23, 27, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 72, 73, 74, 75, 76, 77, 79, 80, 81, 84, 101, 102, 103, 104, 105, 106, 107, 108, 109 |
3D-footprint Homologues: | 5kkq_D, 8ssq_A, 7w1m_H, 8ssu_A, 5yel_A, 6wmi_A, 7n5w_A, 6jnm_A, 8cuc_F, 1tf3_A, 6ml4_A, 2gli_A, 8gn3_A, 1g2f_F, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 1ubd_C, 7ysf_A, 5ei9_F, 1mey_C, 5und_A, 5k5i_A, 2kmk_A, 8h9h_G, 7eyi_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 3uk3_C, 7y3l_A, 1llm_D, 7txc_E, 2wbs_A, 5yj3_D, 2drp_D, 1f2i_J, 4m9v_C, 5v3j_F |
Binding Motifs: | Sp1_SANGER_5_FBgn0020378 gkGGGCGkrkc Sp1_SOLEXA_2.5_FBgn0020378 rrgkGGGCGkgrcc |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.