Transcription Factor

Accessions: Sp1 (FlyZincFinger 1.0 )
Names: CG1343
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 117
Pfam Domains: 31-55 C2H2-type zinc finger
31-55 Zinc finger, C2H2 type
47-74 Zinc-finger double domain
61-85 C2H2-type zinc finger
61-85 Zinc finger, C2H2 type
78-100 Zinc-finger double domain
91-113 Zinc finger, C2H2 type
91-111 Zinc-finger of C2H2 type
91-114 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 YAGRATCDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERP 60
61 FVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTA
Interface Residues: 17, 18, 20, 23, 27, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 72, 73, 74, 75, 76, 77, 79, 80, 81, 84, 101, 102, 103, 104, 105, 106, 107, 108, 109
3D-footprint Homologues: 5kkq_D, 8ssq_A, 7w1m_H, 8ssu_A, 5yel_A, 6wmi_A, 7n5w_A, 6jnm_A, 8cuc_F, 1tf3_A, 6ml4_A, 2gli_A, 8gn3_A, 1g2f_F, 6blw_A, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 1ubd_C, 7ysf_A, 5ei9_F, 1mey_C, 5und_A, 5k5i_A, 2kmk_A, 8h9h_G, 7eyi_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 3uk3_C, 7y3l_A, 1llm_D, 7txc_E, 2wbs_A, 5yj3_D, 2drp_D, 1f2i_J, 4m9v_C, 5v3j_F
Binding Motifs: Sp1_SANGER_5_FBgn0020378 gkGGGCGkrkc
Sp1_SOLEXA_2.5_FBgn0020378 rrgkGGGCGkgrcc
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.