Transcription Factor
| Accessions: | 4hca_A (3D-footprint 20260701) |
| Names: | GATA-binding factor 3, GATA3_HUMAN, Trans-acting T-cell-specific transcription factor GATA-3 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P23771 |
| Length: | 99 |
| Pfam Domains: | 5-38 GATA zinc finger 48-80 GATA zinc finger |
| Sequence: (in bold interface residues) | 1 MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPTSCANCQTTTTTLWR 60 61 RNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKM |
| Interface Residues: | 14, 15, 17, 27, 31, 57, 58, 60, 70, 74, 75, 78, 95, 97, 98 |
| 3D-footprint Homologues: | 3vd6_C, 4hc9_A, 1gat_A, 3dfx_B, 4gat_A |
| Binding Motifs: | 4hca_A tTCTGATAa |
| Binding Sites: | 4hca_X 4hca_Y |
| Publications: | Chen Y, Bates D.L, Dey R, Chen P.H, Machado A.C, Laird-Offringa I.A, Rohs R, Chen L. DNA binding by GATA transcription factor suggests mechanisms of DNA looping and long-range gene regulation. Cell reports 2:1197-206 (2012). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.