Transcription Factor

Accessions: 4hca_A (3D-footprint 20231221)
Names: GATA-binding factor 3, GATA3_HUMAN, Trans-acting T-cell-specific transcription factor GATA-3
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P23771
Length: 99
Pfam Domains: 5-38 GATA zinc finger
48-80 GATA zinc finger
Sequence:
(in bold interface residues)
1 MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPTSCANCQTTTTTLWR 60
61 RNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKM
Interface Residues: 14, 15, 17, 27, 31, 57, 58, 60, 70, 74, 75, 78, 95, 97, 98
3D-footprint Homologues: 4hc9_A, 3vd6_C, 3dfx_B, 1gat_A, 4gat_A
Binding Motifs: 4hca_A tTCTGATAa
Binding Sites: 4hca_X
4hca_Y
Publications: Chen Y, Bates D.L, Dey R, Chen P.H, Machado A.C, Laird-Offringa I.A, Rohs R, Chen L. DNA binding by GATA transcription factor suggests mechanisms of DNA looping and long-range gene regulation. Cell reports 2:1197-206 (2012). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.