Transcription Factor
| Accessions: | T075858_1.02 (CISBP 1.02), A9T5V8 (JASPAR 2024) |
| Names: | e_gw1.170.52.1, T075858_1.02;, A9T5V8_PHYPA, Fragment, Predicted protein |
| Organisms: | Physcomitrella patens, moss |
| Libraries: | CISBP 1.02 1, JASPAR 2024 2 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:Dof |
| Length: | 109 |
| Pfam Domains: | 41-101 Dof domain, zinc finger |
| Sequence: | MIPSSSNHEQQQQQAQLQQQEKKASQLFAQRALQERRLKPPDQVIACPRCQSLNTKFCYY NNYSLTQPRHFCKSCRRYWTAGGTLRNVPVGGGCRKNKRTKPRTPEGQN |
| Binding Motifs: | M0659_1.02 srwAAAGydr MA0987.1 srwAAAGydr |
| Publications: | Yanagisawa S. Dof1 and Dof2 transcription factors are associated with expression of multiple genes involved in carbon metabolism in maize. Plant J. 21:281-288 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.