Transcription Factor
Accessions: | CEBPG_HUMAN (HOCOMOCO 10), P53567 (JASPAR 2024) |
Names: | C/EBP gamma, CCAAT/enhancer-binding protein gamma, CEBPG_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Length: | 150 |
Pfam Domains: | 62-114 Basic region leucine zipper 65-120 bZIP transcription factor |
Sequence: (in bold interface residues) | 1 MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDR 60 61 NSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKD 120 121 LFLEHAHNLADNVQSISTENTTADGDNAGQ |
Interface Residues: | 69, 72, 73, 75, 76, 79, 80 |
3D-footprint Homologues: | 8k8c_A, 2c9l_Z |
Binding Motifs: | MA0838.1 rTTrCGCAAy CEBPG_HUMAN.H10MO.C|M01052 aTKktGcAATctk MA1636.1 adATGATGCAATmwt MA1636.2 ATGATGCAAT |
Binding Sites: | MA1636.1.1 MA1636.1.10 / MA1636.1.5 MA1636.1.11 / MA1636.1.7 MA1636.1.12 MA1636.1.13 / MA1636.1.8 MA1636.1.14 / MA1636.1.9 MA1636.1.15 MA1636.1.16 MA1636.1.10 / MA1636.1.17 MA1636.1.11 / MA1636.1.18 MA1636.1.19 MA1636.1.2 MA1636.1.12 / MA1636.1.20 MA1636.1.3 MA1636.1.3 / MA1636.1.4 MA1636.1.4 / MA1636.1.5 MA1636.1.6 MA1636.1.7 MA1636.1.8 MA1636.1.9 MA1636.1.13 MA1636.1.14 MA1636.1.15 MA1636.1.16 MA1636.1.17 MA1636.1.18 MA1636.1.19 MA1636.1.20 MA1636.1.6 MA1636.2.9 MA1636.2.1 MA1636.2.13 MA1636.2.16 MA1636.2.17 MA1636.2.14 MA1636.2.3 MA1636.2.10 / MA1636.2.4 MA1636.2.2 MA1636.2.11 MA1636.2.12 MA1636.2.15 MA1636.2.18 / MA1636.2.7 MA1636.2.19 MA1636.2.20 MA1636.2.5 MA1636.2.6 MA1636.2.8 |
Publications: | Osada S, Yamamoto H, Nishihara T, Imagawa M. DNA binding specificity of the CCAAT/enhancer-binding protein transcription factor family. J Biol Chem 271:3891-6 (1996). [Pubmed] Hong S, Skaist AM, Wheelan SJ, Friedman AD. AP-1 protein induction during monopoiesis favors C/EBP: AP-1 heterodimers over C/EBP homodimerization and stimulates FosB transcription. J Leukoc Biol 90:643-51 (2011). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.