Transcription Factor
Accessions: | GerE (DBTBS 1.0) |
Names: | GerE, GERE_BACSU |
Organisms: | Bacillus subtilis |
Libraries: | DBTBS 1.0 1 1 Sierro N, Makita Y, de Hoon M, Nakai K. DBTBS: a database of transcriptional regulation in Bacillus subtilis containing upstream intergenic conservation information. Nucleic acids research 36:D93-6 (2008). [Pubmed] |
Uniprot: | P11470 |
Length: | 74 |
Pfam Domains: | 11-64 Bacterial regulatory proteins, luxR family 12-54 Sigma-70, region 4 12-54 Sigma-70, region 4 |
Sequence: (in bold interface residues) | 1 MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRS 60 61 QAVVELLRMGELEL |
Interface Residues: | 39, 40, 41, 42, 44, 45, 46, 48 |
3D-footprint Homologues: | 7ve5_B, 5w43_B, 6ide_A, 1zlk_A, 4wuh_B, 8dq1_C, 1je8_F |
Binding Motifs: | GerE RwwTrGGcrtwy |
Binding Sites: | cgeA_1 cgeA_2 cgeA_3 cgeA_4 cgeA_5 cgeC_1 cotB_1 cotB_2 cotC_1 cotC_2 cotD_1 cotD_2 cotG_1 cotH_1 cotM_1 cotV_1 cotX_1 cotX_2 cotY_1 cotY_2 cwlH_1 ftsY_1 ftsY_2 spoIVCB_1 spoIVCB_2 sspG_1 sspG_2 ydgB_1 yjcZ_1 |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.