Transcription Factor

Accessions: 6u81_A (3D-footprint 20241219)
Names: Double homeobox protein 10, Double homeobox protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9UBX2
Length: 132
Pfam Domains: 2-56 Homeobox domain
23-55 Homeobox KN domain
77-131 Homeobox domain
100-130 Homeobox KN domain
Sequence:
(in bold interface residues)
1 GRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQH 60
61 RRESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRI 120
121 QIWFQNRRARHP
Interface Residues: 5, 43, 46, 47, 50, 51, 53, 54, 65, 77, 78, 79, 80, 118, 119, 121, 122, 125, 126, 129, 130
3D-footprint Homologues: 8pi8_B, 2h8r_B, 8ik5_C, 7xrc_C, 8g87_X, 8bx1_A, 6m3d_C, 8pmf_A, 8ejp_B, 1zq3_P, 2lkx_A, 2ld5_A, 6es3_K, 7psx_B, 2hdd_A, 9b8u_A, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B
Binding Motifs: 6u81_A ctaATCAA
Binding Sites: 6u81_B
6u81_C
Publications: Klingler C, Ashley J, Shi K, Stiefvater A, Kyba M, Sinnreich M, Aihara H, Kinter J. DNA aptamers against the DUX4 protein reveal novel therapeutic implications for FSHD. FASEB J 34:4573-4590 (2020). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.