Transcription Factor

						

			
Accessions: 6r2v_A (3D-footprint 20231221)

			
Names: AtNF-YA-6, NFYA6_ARATH, Nuclear transcription factor Y subunit A-6
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9LVJ7
Length: 62
Pfam Domains:      1-55 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B
Sequence: 
(in bold interface residues)		   1 PIFVNAKQYQAILRRRERRAKLEAQNKLIKVRKPYLHESRHLHALKRVRGSGGRFLNTKK   60
  61 HQ
Interface Residues: 40, 43, 47, 49, 54, 55
3D-footprint Homologues: 4awl_A, 4g92_A, 6r2v_A
Binding Motifs: 6r2v_A CCAATcc
Binding Sites: 6r2v_I
6r2v_J
			
Publications: Chaves-Sanjuan A, Gnesutta N, Gobbini A, Martignago D, Bernardini A, Fornara F, Mantovani R, Nardini M. Structural determinants for NF-Y subunit organization and NF-Y/DNA association in plants. Plant J : (2020). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.