Transcription Factor
Accessions: | 6ml5_A (3D-footprint 20231221) |
Names: | Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, ZBT24_MOUSE, Zinc finger and BTB domain-containing protein 24, Zinc finger protein 450 |
Organisms: | Mus musculus |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | Q80X44 |
Length: | 142 |
Pfam Domains: | 5-15 C2H2-type zinc finger 5-27 Zinc finger, C2H2 type 5-27 C2H2-type zinc finger 34-55 C2H2-type zinc finger 34-55 C2H2-type zinc finger 34-54 Zinc-finger of C2H2 type 48-71 Zinc-finger double domain 60-84 C2H2-type zinc finger 61-83 Zinc-finger of C2H2 type 61-83 Zinc finger, C2H2 type 61-83 C2H2-type zinc finger 75-99 Zinc-finger double domain 89-100 C2H2-type zinc finger 89-111 Zinc finger, C2H2 type 89-111 C2H2-type zinc finger 105-127 Zinc-finger double domain 117-139 C2H2-type zinc finger 117-137 C2H2-type zinc finger 117-139 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 GSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHTGEKP 60 61 FTCEICGKSFTAKSSLQTHIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCP 120 121 ECGLQFARLDNLKAHLKIHSKE |
Interface Residues: | 15, 16, 17, 18, 19, 22, 26, 43, 44, 45, 46, 47, 49, 50, 52, 53, 56, 61, 71, 72, 73, 74, 75, 77, 78, 79, 82, 99, 100, 101, 102, 103, 104, 105, 106, 107, 127, 128, 129, 130, 131, 133, 134, 137 |
3D-footprint Homologues: | 5v3j_F, 6wmi_A, 5ei9_F, 8ssq_A, 7w1m_H, 8ssu_A, 5kkq_D, 1tf6_A, 5yel_A, 2i13_A, 3uk3_C, 8cuc_F, 7y3l_A, 7n5w_A, 5kl3_A, 5und_A, 1f2i_J, 6ml4_A, 2gli_A, 8gn3_A, 4x9j_A, 8h9h_G, 7eyi_G, 6e94_A, 7ysf_A, 7y3m_I, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 1tf3_A, 1llm_D, 1mey_C, 5k5i_A, 1g2f_F, 6blw_A, 6u9q_A, 4m9v_C, 2lt7_A, 6a57_A, 7txc_E, 2wbs_A, 2drp_D, 5yj3_D |
Binding Motifs: | 6ml5_A cAGGTCCTGgACG |
Binding Sites: | 6ml5_E 6ml5_F |
Publications: | Ren R, Hardikar S, Horton JR, Lu Y, Zeng Y, Singh AK, Lin K, Coletta LD, Shen J, Lin Kong CS, Hashimoto H, Zhang X, Chen T, Cheng X. Structural basis of specific DNA binding by the transcription factor ZBTB24. Nucleic Acids Res 47:8388-8398 (2019). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.