Transcription Factor

Accessions: KLF1_HUMAN (HOCOMOCO 10), Q13351 (JASPAR 2024)
Names: EKLF, Erythroid krueppel-like transcription factor, KLF1_HUMAN, Krueppel-like factor 1
Organisms: Homo sapiens
Libraries: HOCOMOCO 10 1, JASPAR 2024 2
1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 362
Pfam Domains: 279-303 Zinc finger, C2H2 type
280-303 C2H2-type zinc finger
295-317 Zinc-finger double domain
309-333 Zinc finger, C2H2 type
309-333 C2H2-type zinc finger
326-350 Zinc-finger double domain
339-361 Zinc finger, C2H2 type
339-361 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPG 60
61 EEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSEASGAQYPPPPETLGAYAGGP 120
121 GLVAGLLGSEDHSGWVRPALRARAPDAFVGPALAPAPAPEPKALALQPVYPGPGAGSSGG 180
181 YFPRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLSCLG 240
241 PGTVGTGLGGTAEDPGVIAETAPSKRGRRSWARKRQAAHTCAHPGCGKSYTKSSHLKAHL 300
301 RTHTGEKPYACTWEGCGWRFARSDELTRHYRKHTGQRPFRCQLCPRAFSRSDHLALHMKR 360
361 HL
Interface Residues: 273, 277, 291, 292, 293, 294, 295, 297, 298, 300, 301, 304, 321, 322, 323, 324, 325, 327, 328, 329, 332, 349, 350, 351, 352, 353, 354, 355, 356, 357, 360
3D-footprint Homologues: 8ssq_A, 7w1m_H, 8ssu_A, 5kkq_D, 6jnm_A, 6ml4_A, 3uk3_C, 8cuc_F, 1tf3_A, 7n5w_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 6blw_A, 5k5i_A, 2kmk_A, 1llm_D, 6u9q_A, 8h9h_G, 5v3j_F, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 7y3l_A, 5yj3_D, 4x9j_A, 1f2i_J, 2wbs_A, 7txc_E, 5yel_A, 2drp_D, 8gn3_A, 4m9v_C
Binding Motifs: KLF1_HUMAN.H10MO.C|M01291 cwGGGTGkGGc
MA0493.2 kGGGyGkGG
MA0493.3 GGGyGkGG
Publications: Miller I. J., Bieker J. J. A novel, erythroid cell-specific murine transcription factor that binds to the CACCC element and is related to the Krueppel family of nuclear proteins. Mol. Cell. Biol. 13:2776-2786 (1993). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.