Transcription Factor
Accessions: | T025913_1.02 (CISBP 1.02), MAFK_MOUSE (HOCOMOCO 10), Q61827 (JASPAR 2024) |
Names: | Mafk, T025913_1.02;, Erythroid transcription factor NF-E2 p18 subunit, MAFK_MOUSE, Transcription factor MafK |
Organisms: | Mus musculus |
Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
Uniprot: | Q61827 |
Notes: | experiment type:PBM, family:bZIP |
Length: | 156 |
Pfam Domains: | 23-115 bZIP Maf transcription factor |
Sequence: (in bold interface residues) | 1 MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK 60 61 NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART 120 121 VARGPVTPTKVATTSVITIVKSAELSSTSVPFSAAS |
Interface Residues: | 57, 61, 64, 65, 68, 69, 72 |
3D-footprint Homologues: | 4eot_A, 7x5e_E, 1skn_P, 7x5e_F, 2wt7_B |
Binding Motifs: | PB0042.1 wwAAwwTGCTGACtt PB0146.1 raaAAAAkTGCAmsr M0290_1.02 wwwtygctga MAFK_MOUSE.H10MO.A|M01197 aawwhTGCTGAsTCAGCa MA0591.1 rssrTGACTCAGCAs MA0591.2 srTGACTCAGCA |
Binding Sites: | MA0591.1.1 MA0591.1.10 / MA0591.1.11 / MA0591.1.8 / MA0591.1.9 MA0591.1.12 MA0591.1.13 MA0591.1.14 MA0591.1.15 MA0591.1.16 MA0591.1.17 MA0591.1.18 MA0591.1.19 MA0591.1.2 MA0591.1.20 MA0591.1.3 MA0591.1.4 MA0591.1.5 MA0591.1.6 MA0591.1.7 MA0591.2.1 MA0591.2.10 / MA0591.2.2 MA0591.2.11 MA0591.2.12 MA0591.2.13 MA0591.2.14 MA0591.2.15 MA0591.2.16 MA0591.2.17 MA0591.2.18 MA0591.2.19 MA0591.2.20 MA0591.2.3 MA0591.2.4 MA0591.2.5 MA0591.2.6 MA0591.2.7 MA0591.2.8 MA0591.2.9 |
Publications: | Kanezaki R., Toki T., Yokoyama M., Yomogida K., Sugiyama K., Yamamoto M., Igarashi K., Ito E. Transcription factor BACH1 is recruited to the nucleus by its novel alternative spliced isoform. J. Biol. Chem. 276:7278-7284 (2001). [Pubmed] Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.