Transcription Factor

Accessions: 1odh_A (3D-footprint 20231221)
Names: Chorion-specific transcription factor GCMa, GCM motif protein 1, GCM1_MOUSE, Glial cells missing homolog 1, MGCM1, mGCMa
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P70348
Length: 157
Pfam Domains: 17-156 GCM motif protein
Sequence:
(in bold interface residues)
1 LSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILK 60
61 KSCLGVVVCSRDCSTEEGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPV 120
121 TNFWRHDGRFIFFQSKGEHDHPRPETKLEAEARRAMK
Interface Residues: 50, 51, 52, 54, 87
3D-footprint Homologues: 1odh_A
Binding Motifs: 1odh_A gcGGG
Binding Sites: 1odh_C
1odh_D
Publications: Cohen S.X, Moulin M, Hashemolhosseini S, Kilian K, Wegner M, Müller C.W. Structure of the GCM domain-DNA complex: a DNA-binding domain with a novel fold and mode of target site recognition. The EMBO journal 22:1835-45 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.