Transcription Factor

Accessions: 1qp9_B (3D-footprint 20260701)
Names: CYP1 activatory protein, CYP1(HAP1-PC7) ACTIVATORY PROTEIN, HAP1_YEASX, Heme activator protein 1, Heme-responsive zinc finger transcription factor HAP1
Organisms: Saccharomyces cerevisiae
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CS82
Length: 74
Pfam Domains: 8-42 Fungal Zn(2)-Cys(6) binuclear cluster domain
Sequence:
(in bold interface residues)
1 KRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELK 60
61 KLRERVKSLEKTLS
Interface Residues: 2, 4, 8, 15, 16, 17
3D-footprint Homologues: 2hap_D, 1pyi_A, 6gys_C, 1zme_D, 7uik_T, 1d66_B, 3coq_A
Binding Motifs: 1qp9_AB CGCnnnTATCGCnnnTAG
1qp9_B ATAnnnGCG
Binding Sites: 1qp9_E
1qp9_F
Publications: Lukens A.K, King D.A, Marmorstein R. Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation. Nucleic acids research 28:3853-63 (2000). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.