Transcription Factor
| Accessions: | 1qp9_B (3D-footprint 20260701) |
| Names: | CYP1 activatory protein, CYP1(HAP1-PC7) ACTIVATORY PROTEIN, HAP1_YEASX, Heme activator protein 1, Heme-responsive zinc finger transcription factor HAP1 |
| Organisms: | Saccharomyces cerevisiae |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0CS82 |
| Length: | 74 |
| Pfam Domains: | 8-42 Fungal Zn(2)-Cys(6) binuclear cluster domain |
| Sequence: (in bold interface residues) | 1 KRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELK 60 61 KLRERVKSLEKTLS |
| Interface Residues: | 2, 4, 8, 15, 16, 17 |
| 3D-footprint Homologues: | 2hap_D, 1pyi_A, 6gys_C, 1zme_D, 7uik_T, 1d66_B, 3coq_A |
| Binding Motifs: | 1qp9_AB CGCnnnTATCGCnnnTAG 1qp9_B ATAnnnGCG |
| Binding Sites: | 1qp9_E 1qp9_F |
| Publications: | Lukens A.K, King D.A, Marmorstein R. Structure of HAP1-PC7 bound to DNA: implications for DNA recognition and allosteric effects of DNA-binding on transcriptional activation. Nucleic acids research 28:3853-63 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.