Transcription Factor
| Accessions: | USF1 (HT-SELEX2 May2017), USF1_HUMAN (HOCOMOCO 10), P22415 (JASPAR 2024) |
| Names: | ENSG00000158773, USF1, bHLHb11, Class B basic helix-loop-helix protein 11, Major late transcription factor 1, Upstream stimulatory factor 1, USF1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3 |
| Length: | 310 |
| Pfam Domains: | 200-254 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM 60 61 YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP 120 121 STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP 180 181 RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK 240 241 GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG 300 301 LEVVIKNDSN |
| Interface Residues: | 201, 203, 204, 205, 207, 208, 211, 212, 216, 238, 240 |
| 3D-footprint Homologues: | 1a0a_B, 1an4_A, 6g1l_A, 4h10_A, 7ssa_L, 5i50_B, 1am9_A, 7xq5_A, 7d8t_A, 4zpk_A, 5nj8_D, 8hov_A, 7f2f_B, 5eyo_A, 7xi3_A, 5v0l_A, 8ia3_B, 7rcu_E, 5gnj_I, 8osl_P, 2ypa_B, 7xi3_B, 7xhv_B |
| Binding Motifs: | MA0093.2 ryCAyGTGACc USF1_2 cmCACGTGaCm USF1_methyl_1 acCAyGTGAYc USF1_HUMAN.H10MO.A|M01591 gGTCACGTGr MA0093.1 CACGTGr MA0093.3 drGTCATGTGACyh MA0093.4 GTCATGTGAC |
| Binding Sites: | MA0093.1.1 / MA0093.1.8 MA0093.1.10 MA0093.1.11 MA0093.1.12 / MA0093.1.5 / MA0093.1.9 MA0093.1.13 MA0093.1.14 MA0093.1.15 MA0093.1.16 MA0093.1.17 MA0093.1.18 MA0093.1.19 MA0093.1.2 MA0093.1.20 MA0093.1.3 MA0093.1.4 MA0093.1.6 MA0093.1.7 MA0093.2.1 MA0093.2.10 MA0093.2.11 MA0093.2.12 MA0093.2.13 MA0093.2.14 MA0093.2.15 MA0093.2.16 MA0093.2.17 MA0093.2.18 MA0093.2.19 MA0093.2.2 MA0093.2.20 MA0093.2.3 MA0093.2.4 MA0093.2.5 MA0093.2.6 MA0093.2.7 MA0093.2.8 MA0093.2.9 MA0093.3.1 MA0093.3.10 MA0093.3.11 MA0093.3.12 MA0093.3.13 / MA0093.3.3 MA0093.3.14 / MA0093.3.4 MA0093.3.15 MA0093.3.16 / MA0093.3.5 MA0093.3.17 MA0093.3.18 MA0093.3.19 MA0093.3.2 MA0093.3.20 MA0093.3.1 / MA0093.3.3 MA0093.3.4 MA0093.3.5 MA0093.3.6 MA0093.3.2 / MA0093.3.7 MA0093.3.8 MA0093.3.9 MA0093.3.9 MA0093.3.10 MA0093.3.11 MA0093.3.12 MA0093.3.13 MA0093.3.14 MA0093.3.15 MA0093.3.16 MA0093.3.17 MA0093.3.18 MA0093.3.19 MA0093.3.20 MA0093.3.6 MA0093.3.7 MA0093.3.8 MA0093.4.1 / MA0093.4.9 MA0093.4.10 / MA0093.4.2 MA0093.4.11 MA0093.4.12 / MA0093.4.13 MA0093.4.14 / MA0093.4.7 MA0093.4.15 / MA0093.4.6 MA0093.4.16 MA0093.4.17 MA0093.4.18 MA0093.4.19 MA0093.4.20 MA0093.4.3 MA0093.4.4 MA0093.4.5 MA0093.4.8 |
| Publications: | Bendall A. J., Molloy P. L. Base preference for DNA binding by the bHLH-Zip protein USF: effects of magnesiumchloride on specificity and comparison with binding of Myc family members. Nucleic Acids Res. 22:2801-2810 (1994). [Pubmed] Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.