Transcription Factor
| Accessions: | Q9JK54 (JASPAR 2024) |
| Names: | Mesogenin-1, MSGN1_MOUSE, Paraxial mesoderm-specific mesogenin1, pMesogenin1, pMsgn1 |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9JK54 |
| Length: | 188 |
| Pfam Domains: | 119-172 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MDNLGETFLSLEDGLDSSDTAGLLASWDWKSRARPLELVQESPTQSLSPAPSLESYSEVA 60 61 LPCGHSGASTGGSDGYGSHEAAGLVELDYSMLAFQPPYLHTAGGLKGQKGSKVKMSVQRR 120 121 RKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNSSG 180 181 REPRPQSV |
| Interface Residues: | 120, 124, 126, 127, 130, 131 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 2ql2_D, 5eyo_A |
| Binding Motifs: | MA1524.2 rrrraCAAATGGygry MA1524.3 raCAAATGGy |
| Binding Sites: | MA1524.2.1 MA1524.2.10 / MA1524.2.20 MA1524.2.11 MA1524.2.12 MA1524.2.13 MA1524.2.14 MA1524.2.15 MA1524.2.16 MA1524.2.17 MA1524.2.18 MA1524.2.19 MA1524.2.2 MA1524.2.20 MA1524.2.3 MA1524.2.4 / MA1524.2.6 MA1524.2.13 / MA1524.2.5 MA1524.2.14 / MA1524.2.6 MA1524.2.15 / MA1524.2.7 MA1524.2.17 / MA1524.2.8 MA1524.2.19 / MA1524.2.9 MA1524.2.10 MA1524.2.11 MA1524.2.12 MA1524.2.16 MA1524.2.18 MA1524.2.4 MA1524.2.5 MA1524.2.7 MA1524.2.8 MA1524.2.9 MA1524.3.1 / MA1524.3.10 / MA1524.3.16 MA1524.3.11 MA1524.3.12 MA1524.3.13 MA1524.3.14 / MA1524.3.19 / MA1524.3.2 MA1524.3.15 MA1524.3.17 MA1524.3.18 MA1524.3.20 MA1524.3.3 MA1524.3.4 / MA1524.3.7 MA1524.3.5 MA1524.3.6 MA1524.3.8 MA1524.3.9 |
| Publications: | Chalamalasetty RB, Dunty WC Jr, Biris KK, Ajima R, Iacovino M, Beisaw A, Feigenbaum L, Chapman DL, Yoon JK, Kyba M, Yamaguchi TP. The Wnt3a/β-catenin target gene Mesogenin1 controls the segmentation clock by activating a Notch signalling program. Nat Commun : (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.