Transcription Factor

Accessions: 5emp_A (3D-footprint 20231221), 5emp_B (3D-footprint 20231221)
Names: GCR_HUMAN, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04150
Length: 71
Pfam Domains: 1-69 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRY 60
61 RKCLQAGMNLE
Interface Residues: 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 53
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B
Binding Motifs: 5emp_A TGttC
5emp_AB GnaCAnnnTGTnC
Binding Sites: 5emp_C
5emp_D
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.