Transcription Factor
| Accessions: | HOXB7 (HT-SELEX2 May2017) |
| Names: | ENSG00000120087, HOXB7 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4u, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4u |
| Length: | 122 |
| Pfam Domains: | 43-99 Homeobox domain |
| Sequence: (in bold interface residues) | 1 LSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKE 60 61 FHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEE 120 121 EE |
| Interface Residues: | 39, 41, 42, 43, 44, 45, 46, 47, 84, 85, 87, 88, 91, 92, 95, 96, 98, 99 |
| 3D-footprint Homologues: | 1b72_A, 1puf_A, 3a01_E, 3cmy_A, 2h1k_B, 5zfz_A, 1fjl_B, 6a8r_A, 1ig7_A, 1jgg_B, 2lkx_A, 6m3d_C, 3d1n_M, 1zq3_P, 3lnq_A, 1nk2_P, 2ld5_A, 6es3_K, 4xrs_G, 3rkq_B, 5flv_I, 2hdd_A, 5zjt_E, 4cyc_A, 2r5y_A, 1puf_B, 7psx_B, 5hod_A, 2hos_A, 7q3o_C, 5jlw_D, 7xrc_C, 1e3o_C, 1le8_A, 1du0_A, 3l1p_A, 4qtr_D, 1o4x_A |
| Binding Motifs: | HOXB7_3 gymATTAm HOXB7_6 gGyAATTArs HOXB7_methyl_1 gyMATTAm HOXB7_methyl_2 rTCrTTAa HOXB7_methyl_4 gGyaATTArs HOXB7_methyl_5 rTCrTTAw |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.