Transcription Factor

Accessions: HOXB7 (HT-SELEX2 May2017)
Names: ENSG00000120087, HOXB7
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4u, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4u
Length: 122
Pfam Domains: 43-99 Homeobox domain
Sequence:
(in bold interface residues)
1 LSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKE 60
61 FHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEE 120
121 EE
Interface Residues: 39, 41, 42, 43, 44, 45, 46, 47, 84, 85, 87, 88, 91, 92, 94, 95, 96, 98, 99
3D-footprint Homologues: 1b72_A, 1puf_A, 3a01_E, 8pmf_A, 1fjl_B, 5zfz_A, 3cmy_A, 1ig7_A, 8ejp_B, 6a8r_A, 3lnq_A, 6m3d_C, 1zq3_P, 2lkx_A, 3d1n_M, 1jgg_B, 2ld5_A, 1nk2_P, 2r5y_A, 7q3o_C, 5jlw_D, 2hos_A, 8eml_B, 6es3_K, 4xrs_G, 1puf_B, 9b8u_A, 3rkq_B, 8ik5_C, 5flv_I, 5zjt_E, 4cyc_A, 8osb_E, 7psx_B, 5hod_A, 2hdd_A, 1e3o_C, 1le8_A, 7xrc_C, 4qtr_D, 8bx1_A, 1o4x_A, 1du0_A
Binding Motifs: HOXB7_3 gymATTAm
HOXB7_6 gGyAATTArs
HOXB7_methyl_1 gyMATTAm
HOXB7_methyl_2 rTCrTTAa
HOXB7_methyl_4 gGyaATTArs
HOXB7_methyl_5 rTCrTTAw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.