Transcription Factor
Accessions: | 3wts_C (3D-footprint 20231221), 3wtt_C (3D-footprint 20231221), 3wtu_C (3D-footprint 20231221), 3wtv_C (3D-footprint 20231221), 3wtw_C (3D-footprint 20231221) |
Names: | ETS1_HUMAN, p54, Protein C-ets-1 |
Organisms: | Homo sapiens |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P14921 |
Length: | 118 |
Pfam Domains: | 17-98 Ets-domain |
Sequence: (in bold interface residues) | 1 PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKR 60 61 KNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK |
Interface Residues: | 14, 47, 51, 52, 55, 69, 70, 72, 73, 74, 76, 77, 91 |
3D-footprint Homologues: | 3zp5_A, 2wbs_A, 8ee9_F, 4mhg_A, 1dux_F, 4uno_A, 3jtg_A, 7jsa_J, 2stt_A, 4bqa_A, 1bc8_C, 4iri_A, 4l18_B, 1yo5_C, 1awc_A, 4lg0_B |
Binding Motifs: | 3wts_AC AGGATGTGGctt 3wts_C aGGa 3wtt_AC gCCACATCCt 3wtu_AC GCCACATCCT 3wtv_AC AGGATGTGGC 3wtw_AC GCCACATCCT |
Binding Sites: | 3wts_D / 3wtt_D / 3wtu_D / 3wtv_D / 3wtw_D 3wts_E / 3wtt_E / 3wtu_E / 3wtv_E / 3wtw_E |
Publications: | Shiina M, Hamada K, Inoue-Bungo T, Shimamura M, Uchiyama A, Baba S, Sato K, Yamamoto M, Ogata K. A Novel Allosteric Mechanism on Protein-DNA Interactions underlying the Phosphorylation-Dependent Regulation of Ets1 Target Gene Expressions. Journal of molecular biology 427:1655-69 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.