Transcription Factor

						

			
Accessions: 5zfy_A (3D-footprint 20231221)

			
Names: Double homeobox protein 10, Double homeobox protein 4-like protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CJ87
Length: 123
Pfam Domains:      3-57 Homeobox domain
    24-56 Homeobox KN domain
   69-123 Homeobox domain
   93-122 Homeobox KN domain
Sequence: 
(in bold interface residues)		   1 RGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQ   60
  61 HRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRR  120
 121 ARH
Interface Residues: 3, 4, 6, 47, 48, 51, 52, 55, 56, 59, 69, 70, 71, 72, 110, 111, 113, 114, 117, 118, 121, 122
3D-footprint Homologues: 5zfz_A, 3d1n_M, 1nk2_P, 4j19_B, 2h8r_B, 1au7_A, 1ic8_B, 7xrc_C, 2xsd_C, 3l1p_A, 8g87_X, 4xrm_B, 6m3d_C, 2h1k_B, 1ig7_A, 1puf_A, 1fjl_B, 3cmy_A, 6a8r_A, 1jgg_B, 3lnq_A, 2lkx_A, 1zq3_P, 2ld5_A, 6es3_K, 4xrs_G, 3a01_E, 5flv_I, 1puf_B, 5zjt_E, 2hdd_A, 7psx_B, 1b72_A, 5hod_A, 3rkq_B, 2r5y_A, 2hos_A, 7q3o_C, 5jlw_D, 4cyc_A, 1e3o_C, 1le8_A, 4qtr_D, 1du0_A
Binding Motifs: 5zfy_A CTAATCTntTCA
Binding Sites: 5zfy_D
5zfy_E
			
Publications: Li Y, Wu B, Liu H, Gao Y, Yang C, Chen X, Zhang J, Chen Y, Gu Y, Li J, Ma J, Gan J. Structural basis for multiple gene regulation by human DUX4. Biochem Biophys Res Commun 505:1161-1167 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.