Transcription Factor

Accessions: 5zfy_A (3D-footprint 20241219)
Names: Double homeobox protein 10, Double homeobox protein 4-like protein 4, DUX4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CJ87
Length: 123
Pfam Domains: 3-57 Homeobox domain
24-56 Homeobox KN domain
69-123 Homeobox domain
93-122 Homeobox KN domain
Sequence:
(in bold interface residues)
1 RGRRRRLVWTPSQSEALRACFERNPYPGIATRERLAQAIGIPEPRVQIWFQNERSRQLRQ 60
61 HRRESPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRR 120
121 ARH
Interface Residues: 6, 44, 47, 48, 51, 52, 54, 55, 56, 69, 70, 71, 72, 110, 111, 113, 114, 117, 118, 121, 122
3D-footprint Homologues: 2h8r_B, 8ik5_C, 8pi8_B, 7xrc_C, 8g87_X, 8bx1_A, 6m3d_C, 8pmf_A, 8ejp_B, 2lkx_A, 1zq3_P, 2ld5_A, 7psx_B, 2hdd_A, 9b8u_A, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 6es3_K
Binding Motifs: 5zfy_A CTAATCTntTCA
Binding Sites: 5zfy_D
5zfy_E
Publications: Li Y, Wu B, Liu H, Gao Y, Yang C, Chen X, Zhang J, Chen Y, Gu Y, Li J, Ma J, Gan J. Structural basis for multiple gene regulation by human DUX4. Biochem Biophys Res Commun 505:1161-1167 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.