Transcription Factor

Accessions: 5yej_C (3D-footprint 20231221)
Names: A0QX69_MYCS2, TetR family transcriptional regulator
Organisms: Mycobacterium smegmatis, Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: A0QX69
Length: 169
Pfam Domains: 8-53 Bacterial regulatory proteins, tetR family
67-150 Tetracyclin repressor, C-terminal all-alpha domain
Sequence:
(in bold interface residues)
1 QLHKPDVVAAATKILDDHGIADLTMRRLARELDVTPGALYWHFANKQELLGAVADHILRT 60
61 ARTDTADLAWREQIHESCRALRDALLSHTDGAELVSASFASGQSVVITEIVEQLGRAARA 120
121 AGVSDADVDAAARTVIYYVLGFTVDEQSRLQWRQFRFGLQLLVDGLAAH
Interface Residues: 25, 26, 35, 36, 37, 38, 40, 41, 57, 59, 61, 63, 64, 66, 68
3D-footprint Homologues: 5yej_B, 5gpc_B, 3zql_B, 5haw_A, 4gck_A, 5vl9_A, 1jt0_C, 6gy3_A, 1qpi_A, 6c31_A, 7jnp_A, 6o6p_B, 4pxi_B, 6wpa_A, 6yl2_A, 6bhx_B
Binding Motifs: 5yej_BC CTTGAACGnTGTTCnnG
Binding Sites: 5yej_D
5yej_F
Publications: Yan L, Tang Q, Guan Z, Pei K, Zou T, He J. Structural insights into operator recognition by BioQ in the Mycobacterium smegmatis biotin synthesis pathway. Biochim Biophys Acta Gen Subj 1862:1843-1851 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.