Transcription Factor

Accessions: 5nj8_B (3D-footprint 20241219)
Names: ARNT protein, ARNT_HUMAN, Aryl hydrocarbon receptor nuclear translocator, bHLHe2, Class E basic helix-loop-helix protein 2, Dioxin receptor, nuclear translocator, HIF-1-beta, HIF1-beta, Hypoxia-inducible factor 1-beta
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P27540
Length: 174
Pfam Domains: 7-53 Helix-loop-helix DNA-binding domain
68-133 PAS fold
Sequence:
(in bold interface residues)
1 DKERLARENHSEIERRRRNKMTAYITELSDMVPTCPDKLTILRMAVSHMKSLRGSYKPSF 60
61 LTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDV 120
121 DKLREQLSTSSRRSFICRMRCHFVVVHCTGYIKAWPDDDPEAKFCLVAIGRLQV
Interface Residues: 10, 11, 13, 14, 17, 18, 38
3D-footprint Homologues: 7ssa_L, 8ia3_B, 8osl_O, 7d8t_A, 7xi3_A, 7rcu_E, 5v0l_A, 8osl_P, 7xhv_B, 5v0l_B, 7xi3_B
Binding Motifs: 5nj8_AB TtgCGTGA
Binding Sites: 5nj8_E
5nj8_F
Publications: Schulte KW, Green E, Wilz A, Platten M, Daumke O. Structural Basis for Aryl Hydrocarbon Receptor-Mediated Gene Activation. Structure 25:1025-1033 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.