Transcription Factor
| Accessions: | RFX5_DBD (HumanTF 1.0), RFX5_TF2 (HumanTF2 1.0), RFX5 (HT-SELEX2 May2017) |
| Names: | DNA-binding protein RFX5, Regulatory factor X 5, RFX5, RFX5_HUMAN, ENSG00000143390 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2, HT-SELEX2 May2017 3 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] 3 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | P48382 |
| Notes: | Ensembl ID: ENSG00000143390; DNA-binding domain sequence; TF family: RFX; Clone source: Gene synthesis, Ensembl ID: ENSG00000143390; Construct type: TF2(3xFLAG); TF family: RFX; Clone source: Jolma et al. 2013, TF family: RFX experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: RFX experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3 |
| Length: | 132 |
| Pfam Domains: | 30-102 RFX DNA-binding domain 44-89 Poxvirus D5 protein-like |
| Sequence: (in bold interface residues) | 1 SDNDKLYLYLQLPSGPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDA 60 61 YRKYCESLACCRPLSTANFGKIIREIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLP 120 121 GLDLKGSESPEM |
| Interface Residues: | 77, 81, 94, 98, 103 |
| 3D-footprint Homologues: | 1dp7_P |
| Binding Motifs: | RFX5_DBD_1 sGTTrCYATGGyAACs RFX5_DBD_2 sGTTrCCATrGCAACs CUX1_RFX5_1 rATCrATagsmdtrCwTaGyAAC CUX1_RFX5_2 rATCRATracktsCcTAGyAAC ETV2_RFX5_1 crCwTCCGsysshrGCAACss ETV2_RFX5_2 rCCGGAArymvCmTAGCAACs ETV2_RFX5_2_3 sryTTCCGGywyrGcAACgr ETV2_RFX5_2_3_4 acCGGAwrygcrcmyrGCAACg HOXB2_RFX5_1 symATTAscvcmyrGyAACs HOXB2_RFX5_2 TAATkrCmtrGCAAC HOXB2_RFX5_2_3 TAATkaccmtrGCAAC TEAD4_RFX5_1 rCATwCYwwwkksscywwwwyrGyAACv TEAD4_RFX5_2 rCATwCCwwamksssyywwtwtrgyAACs RFX5_3 sGTTgCyAkGcGTTGCyak RFX5_4 ayrgcAACsGTTrCyAt RFX5_methyl_1 sGTtGyyrkGsGTTGyyrk RFX5_methyl_2 myrgyaACsGTtrCyAt |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.