Transcription Factor

Accessions: ZNF784_full (HumanTF 1.0)
Names: ZN784_HUMAN, ZNF784
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q8NCA9
Notes: Ensembl ID: ENSG00000179922; Full protein sequence; TF family: znfC2H2; Clone source: hORFeome
Length: 324
Pfam Domains: 115-139 Zinc-finger double domain
129-151 Zinc finger, C2H2 type
196-218 Zinc finger, C2H2 type
196-218 C2H2-type zinc finger
211-235 Zinc-finger double domain
224-246 Zinc finger, C2H2 type
224-244 C2H2-type zinc finger
239-263 Zinc-finger double domain
252-274 Zinc-finger double-stranded RNA-binding
252-274 Zinc-finger of C2H2 type
252-274 Zinc finger, C2H2 type
252-274 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MAAARPEAQSRSSPTPESRSQEPLDLVLVPDDCRPGTPPSDLIEIQVVKVTDTTLVPEPP 60
61 EPGSFHCALCPAAFRLVSELLFHEHGHLAGAEGGGQGGDPSRCHVCGHSCPGPASLRAHY 120
121 SLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAVAEQRPGVAPERAE 180
181 VVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLS 240
241 GHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFHGPGPGLGDSGGQLGSSAAEGSGSG 300
301 CGVGDPAEEGRGETAKVKVEADQ*
Interface Residues: 76, 78, 79, 82, 112, 114, 115, 118, 139, 140, 141, 142, 143, 146, 162, 163, 164, 170, 172, 173, 174, 177, 179, 181, 186, 187, 188, 189, 190, 192, 196, 205, 206, 207, 208, 209, 210, 212, 213, 214, 215, 216, 219, 234, 235, 236, 237, 238, 239, 240, 241, 242, 245, 248, 249, 262, 263, 264, 265, 266, 268, 269
3D-footprint Homologues: 8ssu_A, 8ssq_A, 7w1m_H, 5und_A, 2i13_A, 5yel_A, 6ml4_A, 5v3j_F, 5ei9_F, 2gli_A, 2kmk_A, 8gn3_A, 6jnm_A, 7n5w_A, 1tf3_A, 1tf6_A, 1llm_D, 7eyi_G, 1ubd_C, 4x9j_A, 1mey_C, 6blw_A, 5kkq_D, 6u9q_A, 5kl3_A, 7ysf_A, 1g2f_F, 6wmi_A, 5k5i_A, 4m9v_C, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 5k5l_F, 2wbs_A, 1f2i_J, 7txc_E, 1yuj_A, 2drp_D, 5yj3_D
Binding Motifs: ZNF784_full GTACCTACCT
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.