Transcription Factor
Accessions: | CREB1 (HT-SELEX2 May2017) |
Names: | CREB1, ENSG00000118260 |
Organisms: | Homo sapiens |
Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
Length: | 119 |
Pfam Domains: | 59-116 bZIP transcription factor 64-111 Basic region leucine zipper |
Sequence: (in bold interface residues) | 1 QYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEA 60 61 ARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD |
Interface Residues: | 71, 72, 74, 75, 78, 79 |
3D-footprint Homologues: | 7x5e_F, 1dh3_C, 5t01_B, 5vpe_D |
Binding Motifs: | CREB1_4 srTGACGTr CREB1_5 crTkACGTmAys CREB1_6 rtgaCryGTcAy CREB1_8 srTgACGTcAys CREB1_methyl_1 srTGAyGTCAyg CREB1_methyl_2 brTGACGyr CREB1_methyl_3 srTGAyGYGtd CREB1_methyl_7 brTGAyGTCAyv |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.