Transcription Factor

Accessions: GATA6 (HT-SELEX2 May2017)
Names: ENSG00000141448, GATA6
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_GATA experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Znf_GATA experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 143
Pfam Domains: 24-57 GATA zinc finger
78-111 GATA zinc finger
Sequence:
(in bold interface residues)
1 GAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRP 60
61 LIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKE 120
121 GIQTRKRKPKNINKSKTCSGNSN
Interface Residues: 33, 34, 36, 46, 50, 87, 88, 90, 100, 104, 105, 108, 125, 127, 128
3D-footprint Homologues: 3vd6_C, 4hc9_A, 3dfx_B, 1gat_A, 4gat_A
Binding Motifs: GATA6_2 hGATAAsgATCw
GATA6_methyl_1 wGATAAcrATCw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.