Transcription Factor

Accessions: sug (FlyZincFinger 1.0 )
Names: CG3850
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 161
Pfam Domains: 1-24 Zinc finger, C2H2 type
1-26 C2H2-type zinc finger
58-80 Zinc-finger double domain
69-91 C2H2-type zinc finger
69-91 Zinc finger, C2H2 type
70-91 Zinc-finger of C2H2 type
83-110 Zinc-finger double domain
97-121 C2H2-type zinc finger
116-139 Zinc-finger double domain
127-153 Zinc finger, C2H2 type
128-150 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 FVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHT 60
61 RTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRT 120
121 HSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQ
Interface Residues: 14, 16, 17, 20, 24, 51, 52, 53, 54, 55, 58, 60, 61, 64, 79, 80, 81, 82, 83, 85, 86, 87, 90, 109, 110, 111, 112, 113, 114, 115, 116, 117, 139, 140, 141, 142, 143, 145, 146, 150
3D-footprint Homologues: 1tf6_A, 8ssq_A, 5v3j_F, 8ssu_A, 5k5l_F, 5yel_A, 5kkq_D, 3uk3_C, 8cuc_F, 7n5w_A, 5ei9_F, 1g2f_F, 6ml4_A, 4x9j_A, 2gli_A, 8h9h_G, 5k5i_A, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 6jnm_A, 7w1m_H, 7y3l_A, 1tf3_A, 1f2i_J, 5kl3_A, 2kmk_A, 6blw_A, 1llm_D, 6u9q_A, 4m9v_C, 7y3m_I, 2lt7_A, 6a57_A, 5yj3_D, 7txc_E, 2wbs_A
Binding Motifs: sug_SANGER_5_FBgn0033782 CcgyGGGGGGyckk
sug_SOLEXA_5_FBgn0033782 tyyGyGGGGGGTcbk
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.