Transcription Factor
| Accessions: | sug (FlyZincFinger 1.0 ) |
| Names: | CG3850 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 161 |
| Pfam Domains: | 1-24 Zinc finger, C2H2 type 1-26 C2H2-type zinc finger 58-80 Zinc-finger double domain 69-91 C2H2-type zinc finger 69-91 Zinc finger, C2H2 type 70-91 Zinc-finger of C2H2 type 83-110 Zinc-finger double domain 97-121 C2H2-type zinc finger 116-139 Zinc-finger double domain 127-153 Zinc finger, C2H2 type 128-150 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 FVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHT 60 61 RTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRT 120 121 HSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQ |
| Interface Residues: | 14, 16, 17, 20, 24, 51, 52, 53, 54, 55, 58, 60, 61, 64, 79, 80, 81, 82, 83, 85, 86, 87, 90, 109, 110, 111, 112, 113, 114, 115, 116, 117, 139, 140, 141, 142, 143, 145, 146, 150 |
| 3D-footprint Homologues: | 1tf6_A, 8ssq_A, 5v3j_F, 8ssu_A, 5k5l_F, 5yel_A, 5kkq_D, 3uk3_C, 8cuc_F, 7n5w_A, 5ei9_F, 1g2f_F, 6ml4_A, 4x9j_A, 2gli_A, 8h9h_G, 5k5i_A, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 6jnm_A, 7w1m_H, 7y3l_A, 1tf3_A, 1f2i_J, 5kl3_A, 2kmk_A, 6blw_A, 1llm_D, 6u9q_A, 4m9v_C, 7y3m_I, 2lt7_A, 6a57_A, 5yj3_D, 7txc_E, 2wbs_A |
| Binding Motifs: | sug_SANGER_5_FBgn0033782 CcgyGGGGGGyckk sug_SOLEXA_5_FBgn0033782 tyyGyGGGGGGTcbk |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.