Transcription Factor

Accessions: 1kb6_B (3D-footprint 20231221)
Names: 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR_HUMAN, Vitamin D3 Receptor
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P11473
Length: 101
Pfam Domains: 3-71 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 PRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQACR 60
61 LKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLR
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54, 83, 84
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A
Binding Motifs: 1kb6_AB GGGtnnnnnrGGaCA
1kb6_B aGGaCA
Binding Sites: 1kb6_C
1kb6_D
Publications: Shaffer P.L, Gewirth D.T. Structural basis of VDR-DNA interactions on direct repeat response elements. The EMBO journal 21:2242-52 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.