Transcription Factor
| Accessions: | T095117_1.02 (CISBP 1.02), NKX31_MOUSE (HOCOMOCO 10), P97436 (JASPAR 2024) |
| Names: | Nkx3-1, T095117_1.02;, Homeobox protein NK-3 homolog A, Homeobox protein Nkx-3.1, NKX31_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:Homeodomain |
| Length: | 237 |
| Pfam Domains: | 126-182 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MLRVAEPREPRVEAGGRSPWAAPPTQSKRLTSFLIQDILRDRAERHGGHSGNPQHSPDPR 60 61 RDSAPEPDKAGGRGVAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHNPGDLASAPQV 120 121 TKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT 180 181 KRKQLSEDLGVLEKNSPLSLPALKDDSLPSTSLVSVYTSYPYYPYLYCLGSWHPSFW |
| Interface Residues: | 125, 126, 127, 128, 129, 167, 168, 170, 171, 174, 175, 177, 178, 179, 182 |
| 3D-footprint Homologues: | 8pmf_A, 5zfz_A, 1puf_A, 3cmy_A, 3d1n_M, 8ejp_B, 1fjl_B, 6a8r_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 3lnq_A, 2ld5_A, 6es3_K, 7q3o_C, 8eml_B, 1ig7_A, 4xrs_G, 3a01_E, 3rkq_B, 6m3d_C, 5flv_I, 2hdd_A, 9b8u_A, 5zjt_E, 4cyc_A, 2r5y_A, 1puf_B, 7psx_B, 5hod_A, 2hos_A, 8osb_E, 1b72_A, 5jlw_D, 8ik5_C, 2h8r_B, 7xrc_C, 1e3o_C, 1au7_A, 2xsd_C, 1le8_A, 1o4x_A, 1le8_B, 1du0_A, 8g87_X, 1mnm_C, 8bx1_A, 1k61_B, 4qtr_D |
| Binding Motifs: | PB0048.1 mwwarCCACTTAAsgab MA0124.2 rcCACTTAa M0946_1.02 ttAAGTrsyy NKX31_MOUSE.H10MO.C|M01248 wwTAAGTAtwtww PB0152.1 vmdsvrrGTACyykgma PH0117.1 twywAAGTACTTAaaws MA0124.3 cCACTTA |
| Publications: | Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed] Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed] Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.