Transcription Factor

Accessions: T095117_1.02 (CISBP 1.02), NKX31_MOUSE (HOCOMOCO 10), P97436 (JASPAR 2024)
Names: Nkx3-1, T095117_1.02;, Homeobox protein NK-3 homolog A, Homeobox protein Nkx-3.1, NKX31_MOUSE
Organisms: Mus musculus
Libraries: CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed]
3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 237
Pfam Domains: 126-182 Homeobox domain
Sequence:
(in bold interface residues)
1 MLRVAEPREPRVEAGGRSPWAAPPTQSKRLTSFLIQDILRDRAERHGGHSGNPQHSPDPR 60
61 RDSAPEPDKAGGRGVAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHNPGDLASAPQV 120
121 TKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT 180
181 KRKQLSEDLGVLEKNSPLSLPALKDDSLPSTSLVSVYTSYPYYPYLYCLGSWHPSFW
Interface Residues: 125, 126, 127, 128, 129, 167, 168, 170, 171, 174, 175, 177, 178, 179, 182
3D-footprint Homologues: 8pmf_A, 5zfz_A, 1puf_A, 3cmy_A, 3d1n_M, 8ejp_B, 1fjl_B, 6a8r_A, 2lkx_A, 1jgg_B, 1nk2_P, 1zq3_P, 3lnq_A, 6es3_K, 7q3o_C, 2ld5_A, 1ig7_A, 4xrs_G, 3a01_E, 3rkq_B, 6m3d_C, 5flv_I, 2hdd_A, 9b8u_A, 5zjt_E, 4cyc_A, 2r5y_A, 1puf_B, 7psx_B, 5hod_A, 2hos_A, 8osb_E, 1b72_A, 5jlw_D, 8eml_B, 8ik5_C, 2h8r_B, 7xrc_C, 1e3o_C, 1au7_A, 2xsd_C, 1le8_A, 1le8_B, 1du0_A, 8g87_X, 1mnm_C, 8bx1_A, 1k61_B, 4qtr_D, 1o4x_A
Binding Motifs: PB0048.1 mwwarCCACTTAAsgab
MA0124.2 rcCACTTAa
M0946_1.02 ttAAGTrsyy
NKX31_MOUSE.H10MO.C|M01248 wwTAAGTAtwtww
PB0152.1 vmdsvrrGTACyykgma
PH0117.1 twywAAGTACTTAaaws
MA0124.3 cCACTTA
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]

Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]

Badis G, Berger M.F, Philippakis A.A, Talukder S, Gehrke A.R, Jaeger S.A, Chan E.T, Metzler G, Vedenko A, Chen X, Kuznetsov H, Wang C.F, Coburn D, Newburger D.E, Morris Q, Hughes T.R, Bulyk M.L. Diversity and complexity in DNA recognition by transcription factors. Science (New York, N.Y.) 324:1720-3 (2009). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.