Transcription Factor

Accessions: ZNF263 (HT-SELEX2 May2017)
Names: ENSG00000006194, ZNF263
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: SCAN_KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: SCAN_KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 325
Pfam Domains: 19-40 C2H2-type zinc finger
21-42 C2H2-type zinc finger
22-42 Zinc finger, C2H2 type
76-98 C2H2-type zinc finger
76-98 Zinc finger, C2H2 type
90-115 Zinc-finger double domain
104-126 C2H2-type zinc finger
104-126 Zinc finger, C2H2 type
118-143 Zinc-finger double domain
131-152 C2H2-type zinc finger
132-154 Zinc finger, C2H2 type
132-154 C2H2-type zinc finger
146-171 Zinc-finger double domain
159-171 C2H2-type zinc finger
160-182 C2H2-type zinc finger
160-182 Zinc finger, C2H2 type
216-239 C2H2-type zinc finger
217-239 C2H2-type zinc finger
217-239 Zinc finger, C2H2 type
231-256 Zinc-finger double domain
244-265 C2H2-type zinc finger
245-267 C2H2-type zinc finger
245-267 Zinc finger, C2H2 type
259-284 Zinc-finger double domain
272-295 C2H2-type zinc finger
273-295 C2H2-type zinc finger
273-295 Zinc finger, C2H2 type
290-311 Zinc-finger double domain
300-323 C2H2-type zinc finger
301-323 C2H2-type zinc finger
301-323 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 GASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGN 60
61 PRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLH 120
121 RHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHER 180
181 THERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHT 240
241 GEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERP 300
301 YKCSECGESFSRSSRLMSHQRTHTG
Interface Residues: 31, 33, 37, 59, 61, 62, 66, 69, 86, 87, 88, 89, 90, 92, 93, 95, 96, 99, 114, 115, 116, 117, 118, 120, 121, 122, 124, 142, 143, 144, 145, 146, 147, 148, 149, 150, 170, 171, 172, 173, 174, 177, 198, 199, 200, 201, 202, 209, 212, 217, 227, 228, 229, 230, 231, 234, 240, 254, 255, 256, 257, 258, 259, 261, 262, 266, 283, 284, 285, 286, 287, 288, 290, 311, 312, 313, 314, 315, 317, 318
3D-footprint Homologues: 7w1m_H, 1tf6_A, 1ubd_C, 8cuc_F, 7y3l_A, 7n5w_A, 6ml4_A, 5v3j_F, 8ssq_A, 4x9j_A, 8ssu_A, 5kkq_D, 5ei9_F, 1g2f_F, 8h9h_G, 7ysf_A, 6e94_A, 7y3m_I, 2jpa_A, 5kl3_A, 1llm_D, 6blw_A, 6u9q_A, 4m9v_C, 2lt7_A, 2drp_D, 5k5l_F, 1f2i_J, 2wbs_A, 8gn3_A, 5yj3_D, 5yel_A, 2kmk_A, 3uk3_C, 1tf3_A, 5k5i_A, 2gli_A, 6jnm_A, 6a57_A, 7txc_E
Binding Motifs: ZNF263_2 vGTsCTCCCy
ZNF263_methyl_1 sGTsCTCCCy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.