Transcription Factor
| Accessions: | ZNF263 (HT-SELEX2 May2017) |
| Names: | ENSG00000006194, ZNF263 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: SCAN_KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: SCAN_KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 325 |
| Pfam Domains: | 19-40 C2H2-type zinc finger 21-42 C2H2-type zinc finger 22-42 Zinc finger, C2H2 type 76-98 C2H2-type zinc finger 76-98 Zinc finger, C2H2 type 90-115 Zinc-finger double domain 104-126 C2H2-type zinc finger 104-126 Zinc finger, C2H2 type 118-143 Zinc-finger double domain 131-152 C2H2-type zinc finger 132-154 C2H2-type zinc finger 132-154 Zinc finger, C2H2 type 146-171 Zinc-finger double domain 159-171 C2H2-type zinc finger 160-182 C2H2-type zinc finger 160-182 Zinc finger, C2H2 type 216-239 C2H2-type zinc finger 217-239 C2H2-type zinc finger 217-239 Zinc finger, C2H2 type 231-256 Zinc-finger double domain 244-265 C2H2-type zinc finger 245-267 C2H2-type zinc finger 245-267 Zinc finger, C2H2 type 259-284 Zinc-finger double domain 272-295 C2H2-type zinc finger 273-295 Zinc finger, C2H2 type 273-295 C2H2-type zinc finger 290-311 Zinc-finger double domain 300-323 C2H2-type zinc finger 301-323 C2H2-type zinc finger 301-323 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 GASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGN 60 61 PRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLH 120 121 RHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHER 180 181 THERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHT 240 241 GEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERP 300 301 YKCSECGESFSRSSRLMSHQRTHTG |
| Interface Residues: | 31, 33, 37, 59, 61, 62, 66, 69, 86, 87, 88, 89, 90, 92, 93, 95, 96, 99, 114, 115, 116, 117, 118, 120, 121, 122, 124, 142, 143, 144, 145, 146, 147, 148, 149, 150, 170, 171, 172, 173, 174, 177, 198, 199, 200, 201, 202, 209, 212, 217, 227, 228, 229, 230, 231, 234, 240, 254, 255, 256, 257, 258, 259, 261, 262, 266, 283, 284, 285, 286, 287, 288, 290, 311, 312, 313, 314, 315, 317, 318 |
| 3D-footprint Homologues: | 7w1m_H, 1tf6_A, 1ubd_C, 8cuc_F, 7y3l_A, 7n5w_A, 4x9j_A, 8ssu_A, 5kkq_D, 5ei9_F, 1g2f_F, 6ml4_A, 5v3j_F, 8ssq_A, 8h9h_G, 6e94_A, 7y3m_I, 7ysf_A, 2jpa_A, 6u9q_A, 5kl3_A, 1llm_D, 6blw_A, 4m9v_C, 2lt7_A, 1f2i_J, 2wbs_A, 8gn3_A, 5yj3_D, 2drp_D, 5k5l_F, 5yel_A, 2kmk_A, 1tf3_A, 3uk3_C, 2gli_A, 5k5i_A, 6jnm_A, 6a57_A, 7txc_E |
| Binding Motifs: | ZNF263_2 vGTsCTCCCy ZNF263_methyl_1 sGTsCTCCCy |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.