Transcription Factor

Accessions: 4uuv_A (3D-footprint 20241219), 4uuv_P (3D-footprint 20241219)
Names: Adenovirus E1A enhancer-binding protein, E1A-F, ETS TRANSLOCATION VARIANT 4, ETV4_HUMAN, Polyomavirus enhancer activator 3 homolog, Protein PEA3
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P43268
Length: 96
Pfam Domains: 3-84 Ets-domain
Sequence:
(in bold interface residues)
1 GALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRS 60
61 LRYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD
Interface Residues: 55, 56, 59, 60, 62, 63, 77
3D-footprint Homologues: 8smj_F, 7jsa_J, 8ee9_F, 8smh_F, 1yo5_C
Binding Motifs: 4uuv_AM ACnTCCGnnnnCGGAaGt
4uuv_DP CGGAnGtnnnCGGAaGt
Binding Sites: 4uuv_F
4uuv_Q
4uuv_R
Publications: Cooper C.D, Newman J.A, Aitkenhead H, Allerston C.K, Gileadi O. Structures of the Ets Domains of Transcription Factors ETV1, ETV4, ETV5 and FEV: Determinants of DNA Binding and Redox Regulation by Disulfide bond formation. The Journal of biological chemistry : (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.