Transcription Factor

Accessions: T116953_1.02 (CISBP 1.02), Q9FF65 (JASPAR 2024)
Names: AT5G05090, T116953_1.02;, Homeodomain-like superfamily protein, Q9FF65_ARATH, Similarity to unknown protein, Uncharacterized protein At5g05090
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: experiment type:PBM, family:Myb/SANT
Length: 266
Pfam Domains: 83-133 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MREEDSNWFAKWEEELPSPEELIPLSQSLITPDLAIAFDLHRNNNSNSGQPLPQTTPPQP 60
61 NSSAEIAGDSTGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGL 120
121 TRENVASHLQKYRLYLKRMKSGGGGGGSGDSDHLFASSPVPPHFLHPTSRQSSDLFIPSF 180
181 VPISTQQQHIAAPPSQFLHRQISAVNFTSPTKATDQAMFLARQQSELQQPVFKPSSLHLH 240
241 SQVANYTQDLKSGAKTVLTLFPTRDD
Interface Residues: 83, 122, 123, 126, 127, 130, 131
3D-footprint Homologues: 6qec_A, 7d3t_D, 8xas_E, 6j5b_C
Binding Motifs: M1337_1.02 ayAGAThCGra
MA1737.1 ayAGAThCGra
MA1737.2 AGAThCG
Publications: Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.